Recombinant Neisseria meningitidis serogroup A / serotype 4A UPF0761 membrane protein NMA0700 (NMA0700)

Shipped with Ice Packs
In Stock

Description

Production and Purification

NMA0700 is expressed in E. coli as a His-tagged recombinant protein, enabling affinity chromatography-based purification. Key production parameters:

Process StepDetails
Expression SystemE. coli (plasmid-based)
FormulationLyophilized in Tris/PBS buffer with 6% trehalose, pH 8.0
ReconstitutionRecommended at 0.1–1.0 mg/mL in sterile water, with optional glycerol (5–50%) for stability .
StabilityAvoid repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week.

No post-translational modifications (e.g., glycosylation) are reported, aligning with E. coli’s limitations in eukaryotic protein processing .

Research Applications and Significance

NMA0700 serves as a critical tool for studying N. meningitidis biology and vaccine development:

ApplicationDetails
Structural BiologyPotential use in cryo-EM or X-ray crystallography to resolve membrane topology.
Vaccine TargetsSerogroup A meningococci are a major cause of epidemics in Africa; membrane proteins may offer novel vaccine candidates .
PathogenomicsComparative studies with other serogroups (e.g., B, C) to identify capsule-switching mechanisms .

Comparative Analysis with Related Proteins

NMA0700 differs from other meningococcal membrane proteins in several aspects:

ProteinSerogroupFunctionProduction HostPurity
NMA0700A / 4AUPF0761 family (unknown)E. coli>90%
PorBBPorin (ion channel)E. coli~85%
OpcAAdhesin (CEACAM interaction)E. coli~90%

Challenges and Future Directions

  1. Functional Elucidation: Requires biochemical assays (e.g., membrane insertion studies using SAM/MIM complexes) .

  2. Post-Translational Modifications: Eukaryotic systems (e.g., Bacillus subtilis) may improve folding accuracy for functional studies .

  3. Epidemiological Relevance: Serogroup A strains are hypervirulent in Africa; NMA0700 could inform next-gen vaccines .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol utilizes 50% glycerol; this can be used as a guideline.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
NMA0700; UPF0761 membrane protein NMA0700
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Target Names
NMA0700
Target Protein Sequence
MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFRRGFDSRGRFDDVLKILLLL DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQGWVLKTGADSIELNEL FKLFVYRPLPVERDHVNQAVDAVMMPCLQTLNMTLAEFDAQAKKQQQS
Uniprot No.

Target Background

Database Links

KEGG: nma:NMA0700

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NMA0700 and what is its predicted function?

NMA0700 is a membrane protein from Neisseria meningitidis serogroup A / serotype 4A classified as part of the UPF0761 protein family. Comparative genomic analyses suggest it functions as a possible ribonuclease, though full functional characterization remains incomplete . As an integral membrane protein, it contains 408 amino acids and is part of the meningococcal membrane proteome that distinguishes pathogenic Neisseria species from commensal ones.

The protein has been identified through genome sequencing efforts as encoded by the NMA0700 gene. Current recombinant expression systems typically produce this protein with a histidine tag to facilitate purification .

How does NMA0700 compare to other membrane proteins in Neisseria species?

NMA0700 belongs to a subset of membrane proteins that are specific to pathogenic Neisseria species. Comparative genomic studies have shown that NMA0700 is part of a genetic island that distinguishes meningococci from gonococci and commensal Neisseria species .

Unlike virulence-associated membrane proteins such as PilC (pilin-associated adhesin), immunoglobulin A1 protease, or HmbR (hemoglobin receptor), NMA0700 does not have a clearly defined role in virulence. Its specific characteristics include:

CharacteristicNMA0700Typical Virulence-Associated Membrane Proteins
Size408 amino acidsVariable (300-2000+ amino acids)
GC Content57%44-60%
SpecificityMeningococcus-specificPathogen-specific
FunctionPossible ribonucleaseAdhesion, immune evasion, nutrient acquisition
Subtractive ClonesUnknown1-9

What expression systems are recommended for recombinant production of NMA0700?

For successful recombinant expression of NMA0700, E. coli-based systems have proven effective . When designing an expression strategy, consider:

  • Vector selection: pET-based expression systems with T7 promoters offer good control over expression timing and levels.

  • Affinity tags: Histidine tags (His-tags) positioned at either N- or C-terminus facilitate purification while minimizing interference with membrane insertion .

  • Host strain considerations: E. coli strains like BL21(DE3) or C41(DE3)/C43(DE3) (specialized for membrane proteins) are recommended.

  • Induction conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations often improve membrane protein yield and proper folding.

  • Extraction protocols: Detergent screening is crucial - start with mild detergents like DDM, LMNG, or FC-12 for initial extraction trials.

When establishing purification protocols, remember that as an alpha-helical integral membrane protein, NMA0700 requires specialized handling to maintain structure and function throughout the purification process .

What experimental design considerations are critical when studying NMA0700 function?

When designing experiments to study NMA0700's function, implement rigorous experimental design principles:

  • Power analysis: Conduct a priori power analysis to determine appropriate sample sizes. For example, if investigating enzymatic activity with an expected effect size of 0.8, alpha of 0.05, and desired power of 0.9, calculate the minimum number of replicates needed .

  • Sample size requirements: Maintain a minimum of n=5 independent samples per experimental group to ensure reliable statistical analysis . Example experimental design:

    GroupTreatmentSample SizeJustification
    ControlVector onlyn=5Minimum for statistical validity
    Wild-typeNMA0700-WTn=5Matched to control
    Mutant 1NMA0700-D134An=5Predicted catalytic residue
    Mutant 2NMA0700-H204An=5Predicted catalytic residue
  • Controls: Include both negative controls (vector-only, unrelated membrane protein) and positive controls (known ribonuclease) to validate assay performance.

  • Randomization: Randomize sample processing order and analysis to minimize systematic bias .

  • Blinding: Implement blinding procedures for sample analysis when subjective measurements are involved.

Following these design principles will significantly improve data reliability and interpretation of NMA0700 function .

How should membrane protein biogenesis studies be designed for NMA0700?

When investigating NMA0700 membrane integration, consider the following methodological approach based on current membrane protein biogenesis models:

  • Determine insertion pathway: Design experiments to distinguish between Oxa1 and SecY-dependent insertion mechanisms. NMA0700, with its predicted multi-transmembrane domain structure, likely utilizes both pathways depending on the topology of specific domains .

  • Analyze transmembrane domain characteristics: Map hydrophobicity profiles and predict transmembrane segments to identify domains that might use different insertion mechanisms:

    • TMDs with short flanking translocated segments (<50 amino acids) may utilize Oxa1-family insertases

    • TMDs with longer flanking segments likely require the SecY channel

  • Experimental validation: Use in vitro translation-translocation assays with purified components (SecY, Oxa1) and crosslinking approaches to verify insertion pathways.

  • Topology mapping: Employ reporter fusion techniques (PhoA/GFP fusions) at predicted loops to experimentally verify membrane topology.

This unified approach to membrane protein biogenesis studies will provide valuable insights into how NMA0700 achieves its native conformation in the bacterial membrane .

How can researchers effectively analyze the potential ribonuclease activity of NMA0700?

To characterize the putative ribonuclease activity of NMA0700, a systematic approach combining biochemical assays and structural analysis is recommended:

  • Substrate specificity determination:

    • Test activity against various RNA substrates (tRNA, rRNA, mRNA)

    • Employ gel-based degradation assays with radiolabeled or fluorescently-labeled substrates

    • Quantify cleavage products using densitometry or fluorescence detection

  • Biochemical characterization:

    • Determine optimal reaction conditions (pH, temperature, metal ion requirements)

    • Perform enzyme kinetics studies (Km, Vmax, kcat) using varying substrate concentrations

    • Test inhibitors to classify the type of ribonuclease activity

  • Structure-function analysis:

    • Generate site-directed mutations of predicted catalytic residues

    • Compare activity levels of wild-type vs. mutant proteins

    • Consider the membrane environment's influence on catalytic activity

  • Cellular relevance investigation:

    • Create gene knockout/complementation strains in N. meningitidis

    • Analyze RNA profiles in wild-type vs. knockout strains

    • Measure changes in gene expression using RNA-seq approaches

When analyzing results, implement Latin Square Design for experiments with multiple variables (e.g., different substrates, pH conditions, and protein variants) to efficiently control for environmental factors while minimizing experimental units .

What approaches should be used to study NMA0700's role in N. meningitidis pathogenicity?

To investigate NMA0700's potential contribution to N. meningitidis pathogenicity, design experiments that connect molecular function to virulence phenotypes:

  • Genetic manipulation strategies:

    • Generate clean deletion mutants (ΔNMA0700) in relevant clinical isolates

    • Create complemented strains with wild-type and catalytically inactive variants

    • Consider conditional expression systems for essential genes

  • Infection model selection:

    • In vitro: Human nasopharyngeal or endothelial cell adhesion/invasion assays

    • Ex vivo: Human whole blood survival assays

    • In vivo: Mouse models of meningococcal infection (if appropriate)

  • Experimental design considerations:

    • Implement complete block designs with multiple isolates and cell types

    • Include complemented strains to confirm phenotype specificity

    • Measure multiple virulence parameters (adhesion, invasion, survival)

  • Comparative genomic context:

    • Analyze NMA0700 conservation across pathogenic Neisseria species

    • Compare with NMA0700 distribution identified in previous comparative genomics studies

    • Correlate presence/absence with virulence phenotypes

Remember that NMA0700 is part of a group of meningococcus-specific proteins identified through genomic island analysis, supporting its potential role in species-specific adaptations rather than universal virulence mechanisms .

How can researchers overcome challenges in membrane protein purification for structural studies of NMA0700?

Membrane protein purification represents a significant challenge in NMA0700 research. To optimize purification protocols for structural studies:

  • Detergent screening optimization:

    • Implement systematic detergent screening using a factorial design approach

    • Evaluate protein stability using thermostability assays (CPM assay, nanoDSF)

    • Test detergent combinations using the following screening matrix:

    Detergent ClassPrimary ScreeningSecondary Optimization
    MaltosideDDM, DMUDM, NG-DDM mixtures
    GlucosideOG, NGVarious chain lengths
    Fos-cholineFC-12, FC-14FC-10, FC-16
    Neopentyl glycolLMNG, DMNGOGNG, mixed micelles
  • Expression optimization:

    • Test expression in different E. coli strains (BL21, C41/C43, Lemo21)

    • Vary induction conditions using response surface methodology

    • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Purification strategy refinement:

    • Implement multiple chromatography steps (IMAC, ion exchange, size exclusion)

    • Monitor protein homogeneity by SEC-MALS and negative-stain EM

    • Consider lipid supplementation during purification

  • Stability enhancement:

    • Screen lipid additives (native lipids, CHS, specific phospholipids)

    • Test stabilizing mutations based on computational predictions

    • Evaluate antibody fragments or nanobodies as stabilizing partners

By systematically addressing these challenges through well-designed experiments, researchers can overcome the difficulties inherent in membrane protein biochemistry .

How can experimental design principles be applied to resolve conflicting data about NMA0700 function?

When faced with conflicting results regarding NMA0700 function, apply robust experimental design principles to resolve discrepancies:

  • Systematic analysis of variables:

    • Identify all experimental variables that differ between conflicting studies

    • Design experiments that systematically test each variable's impact

    • Use factorial experimental designs to efficiently test multiple factors

  • Statistical power considerations:

    • Ensure adequate sample sizes through a priori power analysis

    • Maintain minimum n=5 independent replicates per condition

    • Calculate effect sizes to determine biological significance beyond statistical significance

  • Method validation approach:

    • Cross-validate using multiple complementary techniques

    • Include appropriate positive and negative controls

    • Test assumptions underlying each experimental method

  • Replication strategy:

    • Implement both technical and biological replication

    • Consider inter-laboratory validation for contentious findings

    • Distinguish between random error and systematic bias

  • Data integration framework:

    • Use Bayesian approaches to integrate conflicting datasets

    • Weight evidence based on methodological rigor

    • Develop testable models that account for apparent contradictions

Sample experimental design for resolving conflicting functional data:

FactorLevelsJustification
Protein preparationDetergent-solubilized, Nanodisc-reconstitutedTest membrane environment effects
Buffer conditionspH 6.5, pH 7.4, pH 8.0Evaluate pH dependence
Substrate typessRNA, dsRNA, structured RNAIdentify substrate specificity
Assay methodGel-based, FRET-based, colorimetricCross-validate activity measurements

By implementing this systematic approach with rigorous controls and replication, researchers can resolve contradictions and develop a more accurate model of NMA0700 function .

What novel approaches could advance understanding of NMA0700's role in bacterial membrane biology?

To further elucidate NMA0700's role in bacterial membrane biology, consider these innovative research directions:

  • Cryo-EM structural analysis:

    • Determine high-resolution structure in different conformational states

    • Map potential substrate binding sites and catalytic residues

    • Compare structural features with known ribonucleases

  • Interactome mapping:

    • Implement proximity labeling approaches (BioID, APEX) in native N. meningitidis

    • Identify protein interaction partners through co-immunoprecipitation studies

    • Use crosslinking mass spectrometry to capture transient interactions

  • Single-molecule approaches:

    • Apply single-molecule FRET to monitor substrate binding and catalysis

    • Use high-speed AFM to visualize conformational dynamics

    • Implement nanopore recording to study single-channel properties if appropriate

  • Systems biology integration:

    • Combine transcriptomics, proteomics, and metabolomics in knockout vs. wild-type strains

    • Develop computational models of NMA0700's role in cellular networks

    • Use genome-wide interaction screens (Tn-Seq) to identify genetic interactions

  • Membrane microdomain analysis:

    • Investigate NMA0700 localization within bacterial membrane microdomains

    • Study co-localization with other membrane proteins using super-resolution microscopy

    • Determine if function depends on specific lipid environments

These approaches, implemented with rigorous experimental design principles, will significantly advance understanding of this relatively uncharacterized membrane protein and potentially reveal new aspects of bacterial membrane biology .

How can researchers effectively design experiments to determine if NMA0700 represents a potential therapeutic target?

To evaluate NMA0700 as a potential therapeutic target against N. meningitidis, design a comprehensive target validation strategy:

  • Essentiality assessment:

    • Conduct conditional knockdown experiments in various growth conditions

    • Perform Tn-Seq analysis to quantify fitness contributions

    • Compare growth kinetics between wild-type and knockout strains

  • Druggability evaluation:

    • Conduct in silico pocket analysis based on structural predictions

    • Develop functional assays amenable to high-throughput screening

    • Identify potential allosteric regulatory sites

  • Target validation experimental design:

    • Implement both genetic and chemical validation approaches

    • Design experiments with the following structure:

    Validation ApproachPrimary AssaySecondary ConfirmationTertiary Validation
    GeneticGrowth inhibitionComplementation analysisIn vivo infection models
    ChemicalEnzymatic inhibitionCellular activitySpecificity profiling
  • Therapeutic window assessment:

    • Compare with human homologs to evaluate potential off-target effects

    • Determine protein conservation across bacterial species

    • Test effects on commensal Neisseria species

  • Resistance potential analysis:

    • Perform directed evolution studies to identify resistance mechanisms

    • Analyze natural sequence variation across clinical isolates

    • Model structural effects of potential resistance mutations

When designing these experiments, ensure proper statistical design with adequate replication (minimum n=5 per condition) and appropriate controls to generate reliable data that can inform therapeutic development decisions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.