Recombinant Neisseria meningitidis serogroup B Capsule polysaccharide export inner-membrane protein CtrB (ctrB)

Shipped with Ice Packs
In Stock

Description

Introduction

Neisseria meningitidis serogroup B is a bacterium that causes meningitis and septicemia . A major virulence factor of N. meningitidis is its capsular polysaccharide (CPS), and its expression is subject to frequent phase variation and is tightly regulated at the transcriptional level . The export of CPS to the bacterium's surface needs two proteins that form an ABC transporter (CtrC and CtrD) and two additional proteins, CtrA and CtrB, which are proposed to form a cell envelope-spanning export complex . CtrB is an inner membrane protein that belongs to the polysaccharide co-polymerase (PCP) family .

Structure and Function of CtrB

CtrB is crucial for exporting the serogroup B capsule polysaccharide to the bacterial surface . It is an inner membrane protein that belongs to the polysaccharide co-polymerase (PCP) family . Cryo-EM images show that CtrB forms a conical oligomer that extends ∼125 Å from the membrane, which is consistent with CtrB functioning as a component of an envelope-spanning complex .

Role in Polysaccharide Export

In N. meningitidis, the export of PSA to the surface of the bacterium requires CtrC and CtrD, which form an ABC transporter, as well as CtrA and CtrB, which form a cell envelope-spanning export complex . CtrA is a member of the outer membrane polysaccharide export (OPX) family of proteins, which are proposed to form a pore to mediate export of CPSs across the outer membrane .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctrB; NMB0072; Capsule polysaccharide export inner-membrane protein CtrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
ctrB
Target Protein Sequence
MSEQLPVAVATETKAERKKPKKKSWIKKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQS SFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVGEYMRSRSSLDELRKILPVREFYET KGDAFSRFNGFGFRGEEEAFYQYYKNQVMINFDTVSGISTLNVTSFDALESKKINEALLK QGEALINQLNDRARADTVRYAEEVVKTAAERVKEASQNLTDYRIANGVFDLKAQSEVQMG LVSKLQDELIVIQTQLDQVKAVTPENPQIPGLQAREQSLRKEIDQQLRAISGGGHSSLSN QAAEYQRVYLENQLAEQQLAAAMTSLESAKVEADRQQLYLEVISQPSLPDLAHEPKRLYN IVATLIIGLMVYGILSLLTASIREHKN
Uniprot No.

Target Background

Function

CtrB is implicated in forming an ATP-driven capsule polysaccharide export apparatus, likely in conjunction with CtrC and CtrD proteins.

Database Links

KEGG: nme:NMB0072

STRING: 122586.NMB0072

Protein Families
BexC/CtrB/KpsE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of CtrB in Neisseria meningitidis serogroup B capsule biosynthesis?

CtrB functions as an essential inner-membrane protein in the capsular polysaccharide export system of N. meningitidis. It forms part of the transport apparatus responsible for exporting capsular polysaccharides from the cytoplasm to the cell surface. In serogroup B strains, CtrB specifically aids in the export of the α2→8-linked polysialic acid capsular polysaccharide, which is a major virulence determinant . The protein works within a multi-component transport system that includes other proteins encoded in the capsular biosynthetic and transport operons. Unlike outer membrane components, CtrB operates at the inner membrane interface to facilitate the initial stages of polysaccharide translocation across the cell envelope.

What are the optimal protocols for expressing and purifying recombinant CtrB protein for structural and functional studies?

For effective expression and purification of recombinant CtrB, a specialized approach for membrane proteins is essential. Based on methodologies used for other meningococcal membrane proteins, researchers should consider the following protocol:

  • Gene cloning: Amplify the ctrB gene using high-fidelity PCR with primers containing appropriate restriction sites (such as NdeI and BamHI as used for tbpA in related studies) .

  • Expression vector selection: Clone the gene into a vector suitable for membrane protein expression, such as a modified pMTL series vector with a strong, inducible promoter .

  • Expression system: While E. coli is commonly used for recombinant protein expression, membrane proteins like CtrB may require specialized strains (C41 or C43) designed for membrane protein overexpression to prevent toxicity.

  • Induction conditions: Optimize IPTG concentration and induction temperature (typically lower temperatures of 16-25°C) to enhance proper folding.

  • Membrane fraction isolation: After cell disruption, separate the membrane fraction by ultracentrifugation (100,000 × g for 1 hour).

  • Detergent solubilization: Solubilize the membrane fraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

  • Purification: Perform affinity chromatography using a histidine tag, followed by size exclusion chromatography to obtain pure protein.

For functional characterization, it's critical to verify that the recombinant protein retains its native conformation, which can be assessed through circular dichroism spectroscopy and activity assays.

How can researchers effectively design mutagenesis studies to identify critical functional domains in CtrB?

To effectively design mutagenesis studies for identifying critical functional domains in CtrB, researchers should implement a systematic approach:

  • Sequence alignment analysis: Perform multiple sequence alignments of CtrB with homologous proteins from different Neisseria strains and other bacteria to identify conserved regions likely crucial for function.

  • Topology prediction: Use bioinformatic tools to predict transmembrane domains and topology to guide the selection of residues for mutagenesis.

  • Targeted mutagenesis strategies:

    • Alanine scanning: Systematically replace conserved residues with alanine

    • Charge reversal mutations: Change charged residues to opposite charges

    • Conservative substitutions: Replace residues with chemically similar amino acids to refine functional importance

  • Functional assessment: Evaluate mutant phenotypes through:

    • Capsule expression assays (flow cytometry with anti-capsular antibodies)

    • Capsule export efficiency measurements

    • Protein localization studies using fluorescent tags

    • Complementation experiments in ctrB knockout strains

  • Data analysis: Create a comprehensive table documenting mutation effects:

MutationLocationCapsule Expression (%)Protein LocalizationComplementation Efficiency
Wild-typeN/A100Inner membrane100%
D45ATM1[Value][Location][Value]
R78ELoop 2[Value][Location][Value]
etc.etc.[Value][Location][Value]

This systematic approach allows for precise identification of residues and domains critical for CtrB function in capsular polysaccharide export.

What assays can be used to measure CtrB-mediated polysaccharide export in laboratory settings?

Several complementary assays can be employed to measure CtrB-mediated polysaccharide export in laboratory settings:

  • Quantitative Capsule Expression Assays:

    • ELISA using anti-capsular antibodies

    • Flow cytometry with fluorescently-labeled anti-capsular antibodies

    • Alcian blue binding assays for polysaccharide quantification

  • Genetic Reporter Systems:

    • Construction of ctrB-reporter gene fusions to monitor expression

    • Complementation assays in ctrB-deficient strains measured by capsule restoration

  • Biochemical Transport Assays:

    • Radiolabeled polysaccharide precursor incorporation studies

    • Membrane vesicle-based transport assays with purified components

  • Microscopy Techniques:

    • Immunogold electron microscopy to visualize capsule localization

    • Fluorescence microscopy using labeled antibodies against capsular polysaccharides

  • Growth-Based Functional Assays:

    • Serum resistance tests (the capsule provides protection against complement-mediated killing)

    • Growth under iron-limited conditions (which can affect capsule expression)

For comparative analysis, researchers should include appropriate controls:

  • Wild-type N. meningitidis strains

  • ctrB knockout mutants

  • Strains grown with and without EDDHA (iron chelator) to manipulate expression

These assays should be performed using standardized protocols similar to those established for evaluating other meningococcal surface components, such as the bactericidal antibody assays described for TbpA and TbpB studies .

How does CtrB interact with other proteins in the capsular polysaccharide export pathway?

CtrB functions as part of a multi-component capsular polysaccharide export system in N. meningitidis, engaging in several protein-protein interactions that are essential for transport efficiency. While the search results don't provide specific details about CtrB interactions, research on bacterial polysaccharide export systems suggests the following interaction network:

  • Inner Membrane Complex Formation:

    • CtrB likely interacts with other inner membrane proteins in the Ctr system (such as CtrC and CtrD) to form a functional translocation complex.

    • These interactions can be studied using techniques such as bacterial two-hybrid assays, co-immunoprecipitation, and cross-linking studies.

  • Interface with Biosynthetic Machinery:

    • Research into capsule biosynthesis indicates that export proteins like CtrB must interface with enzymes responsible for polysaccharide synthesis.

    • The efficiency of capsule expression depends on coordinated activity between biosynthetic enzymes and transport proteins, suggesting functional coupling similar to that observed in other bacterial systems.

  • Periplasmic and Outer Membrane Connections:

    • The complete export pathway involves proteins spanning the cell envelope, similar to the comprehensive transport systems described for other meningococcal surface components .

    • CtrB likely interacts with periplasmic components that facilitate the continued transport of polysaccharides toward the outer membrane.

Understanding these protein-protein interactions is particularly important when considering capsule switching between serogroups as described in the research on meningococcal capsule diversity . The conservation of transport proteins like CtrB across different serogroups suggests that these proteins maintain core interactions regardless of the specific polysaccharide being transported.

What is the impact of ctrB gene mutations or polymorphisms on meningococcal virulence and host immune responses?

Mutations or polymorphisms in the ctrB gene can significantly impact meningococcal virulence and host immune responses through several mechanisms:

  • Capsule Expression Effects:

    • Defects in CtrB function can lead to reduced capsule surface expression, even when biosynthetic genes remain intact.

    • Studies of capsule transport systems suggest that even subtle mutations in export proteins can cause accumulation of polysaccharides in the periplasm rather than on the cell surface .

  • Virulence Implications:

    • Since the polysialic acid capsule of serogroup B meningococci is a major virulence determinant, disruption of CtrB function typically results in attenuated virulence.

    • The capsule provides protection against complement-mediated killing and phagocytosis; therefore, reduced capsule export correlates with increased susceptibility to host immune defenses.

  • Host Immune Recognition:

    • Alterations in capsule export efficiency can expose subcapsular antigens to immune recognition.

    • This may enhance recognition by antibodies targeting proteins like TbpA and TbpB, which have been studied as vaccine candidates .

  • Vaccine Development Considerations:

    • Understanding CtrB polymorphisms is relevant for vaccine development strategies targeting the capsular export machinery.

    • While current vaccine approaches focus more on outer membrane proteins and capsular polysaccharides , the export machinery represents a potential alternative target.

The relationship between genetic variations in transport genes and clinical outcomes was indirectly demonstrated in studies of capsule switching between serogroups, where the basic transport machinery remained functional despite changes in the type of polysaccharide being exported . This suggests that the core function of CtrB is preserved even as other aspects of capsule biochemistry evolve.

How do environmental factors such as iron availability affect ctrB gene expression and protein function?

Environmental factors, particularly iron availability, significantly influence ctrB gene expression and protein function in N. meningitidis through complex regulatory mechanisms:

  • Iron-Dependent Regulation:

    • While the search results don't directly address ctrB regulation, they indicate that iron availability affects expression of other meningococcal membrane proteins like TbpA and TbpB .

    • By extension, capsule export systems are likely subject to similar environmental regulation, as capsule expression is known to respond to environmental signals.

  • Experimental Evidence of Iron Effects:

    • Studies have employed iron chelators like EDDHA to manipulate iron availability in laboratory settings .

    • Using similar approaches, researchers have observed that iron limitation typically enhances the expression of virulence factors, which may include capsule export proteins.

  • Transcriptional Control Mechanisms:

    • Iron-responsive transcriptional regulators (such as Fur) likely influence ctrB expression as part of a coordinated response to environmental conditions.

    • Co-regulation with other virulence factors ensures appropriate deployment of pathogenic mechanisms in response to host environments.

  • Physiological Relevance:

    • Iron restriction is a key host defense mechanism encountered by N. meningitidis during infection.

    • Upregulation of capsule production and export under iron-limited conditions would provide a selective advantage during pathogenesis.

  • Experimental Approaches to Study Environmental Regulation:

    • qRT-PCR to measure ctrB transcript levels under varying iron conditions

    • Reporter gene fusions to monitor expression in real-time

    • Proteomic analysis to quantify CtrB protein levels under different growth conditions

These regulatory relationships highlight the sophisticated adaptation of N. meningitidis to the host environment and suggest that therapeutic strategies targeting CtrB might need to account for expression variability under different conditions.

What is the potential of CtrB as a vaccine antigen compared to other meningococcal surface proteins?

The potential of CtrB as a vaccine antigen must be evaluated in the context of other meningococcal surface proteins that have already shown promise in vaccine development:

AntigenAntibody Titer (Geometric Mean)Bactericidal ActivityCross-Strain ProtectionClinical Development Stage
TbpA10,408 ModerateGoodPreclinical
TbpB1,573 HighLimitedPreclinical
rMenB+OMVNot specifiedGood against homologous strainsModerateClinical trials
CtrBNot establishedNot establishedPotentially goodTheoretical

The limited surface accessibility of CtrB suggests it may not be an ideal primary vaccine target, but its conservation makes it worthy of investigation as part of comprehensive vaccine strategies.

How might capsule switching impact the efficacy of CtrB-targeted therapeutic approaches?

Capsule switching in N. meningitidis has significant implications for CtrB-targeted therapeutic approaches:

The phenomenon of capsule switching underscores the value of targeting highly conserved components of the capsule export machinery as a potentially more stable therapeutic strategy compared to approaches that target the variable capsular polysaccharides themselves.

What methodological approaches can be used to evaluate the immunogenicity and protective efficacy of recombinant CtrB protein in vaccine formulations?

Comprehensive evaluation of recombinant CtrB protein as a vaccine component requires systematic methodological approaches across multiple experimental systems:

  • Immunogenicity Assessment Protocols:

    • ELISA-based antibody titer determination similar to that used for TbpA/TbpB studies, which revealed geometric mean titers of 10,408 for TbpA and 1,573 for TbpB .

    • Western blot analysis to confirm antibody specificity and cross-reactivity with native CtrB.

    • Epitope mapping to identify immunodominant regions that could be incorporated into optimized vaccine designs.

  • Functional Antibody Assays:

    • Serum bactericidal antibody (SBA) assays using standardized methods as described in meningococcal vaccine research, with human complement sources screened for lack of pre-existing antibodies .

    • Growth inhibition assays under various conditions, including iron limitation with EDDHA supplementation .

    • Assays measuring inhibition of capsule export as a direct functional readout of anti-CtrB activity.

  • Animal Model Testing Strategy:

    • Mouse intraperitoneal infection models similar to those used for TbpA/TbpB evaluation .

    • Dose-response studies with various adjuvant formulations.

    • Challenge with diverse meningococcal strains to assess cross-protection, particularly including strains that have undergone capsule switching .

  • Formulation Optimization:

    • Testing CtrB alone and in combination with other antigens, following the precedent of combination vaccines like rMenB+OMV .

    • Adjuvant screening to enhance immunogenicity while maintaining safety profile.

    • Stability testing across storage conditions relevant to vaccine deployment.

  • Clinical Trial Design Considerations:

    • Phase II controlled trial designs similar to those used for recombinant meningococcal vaccines, with randomized allocation and appropriate control groups .

    • Multi-center approach to ensure diverse population sampling and robust results.

    • Age-stratified cohorts with particular focus on infants, who are at greatest risk of meningococcal disease .

  • Immunization Schedule Evaluation:

    • Testing various dosing regimens, such as the "2, 4, 6, and 12 months of age" schedule used in rMenB+OMV trials .

    • Comparison of multiple-dose versus single-dose efficacy to determine minimum effective immunization protocols.

  • Safety Assessment Framework:

    • Systematic recording of local and systemic reactogenicity for 7 days post-vaccination, as per established protocols .

    • Long-term follow-up for adverse events of special interest.

    • Comparative safety analysis against existing meningococcal vaccines.

This comprehensive methodological approach ensures rigorous evaluation of CtrB's potential as a vaccine component while building on established protocols that have successfully advanced other meningococcal antigens through the development pipeline.

What are the technical challenges in studying the structure-function relationship of CtrB as an inner membrane protein?

Studying the structure-function relationship of CtrB presents several significant technical challenges inherent to inner membrane proteins:

These technical challenges explain why structural studies on membrane proteins like CtrB lag behind those of soluble proteins, despite their biological and clinical importance.

How might systems biology approaches enhance our understanding of CtrB's role in the broader context of meningococcal pathogenesis?

Systems biology approaches offer powerful frameworks to contextualize CtrB's role within the complex network of meningococcal pathogenesis:

  • Integrative Multi-Omics Analysis:

    • Combining transcriptomics, proteomics, and metabolomics data to map how CtrB expression correlates with global cellular processes.

    • Identifying co-expressed genes and proteins to reveal functional associations not evident from focused studies.

    • Metabolomic fingerprinting to detect how CtrB dysfunction affects broader cellular metabolism, particularly regarding capsule precursor accumulation.

  • Network-Based Modeling Approaches:

    • Construction of protein-protein interaction networks to position CtrB within the meningococcal interactome.

    • Pathway enrichment analysis to understand how CtrB connects to virulence networks.

    • Bayesian network modeling to predict causal relationships between CtrB function and downstream pathogenic processes.

  • Comparative Systems Analysis:

    • Cross-strain comparison of expression patterns to identify strain-specific adaptations in capsule export systems.

    • Examination of how capsule switching events affect global regulatory networks beyond the capsule biosynthesis operon.

    • Analysis of system-level differences between strains with varying virulence potential.

  • Host-Pathogen Interface Mapping:

    • Integration of bacterial and host transcriptomics to understand how CtrB-dependent capsule expression modulates host responses.

    • Systems-level analysis of how antibodies against different bacterial components (like those studied for TbpA and TbpB ) affect global bacterial adaptation.

  • Predictive Modeling Applications:

    • Development of machine learning models to predict the impact of CtrB mutations on meningococcal fitness and virulence.

    • In silico screening of potential inhibitors targeting CtrB or its interaction partners.

    • Simulation of evolutionary trajectories under selective pressures like vaccine-induced immunity.

  • Practical Implementation Strategies:

    • Generation of CtrB conditional mutants for temporal expression control.

    • Application of CRISPRi for fine-tuned repression of ctrB expression.

    • Development of fluorescent reporters for real-time visualization of CtrB activity in living cells.

These systems approaches would provide a more holistic understanding of how CtrB contributes to meningococcal biology beyond its immediate role in capsule export, potentially revealing unexpected therapeutic targets or diagnostic markers.

What emerging technologies might advance the development of CtrB-targeted antimicrobial strategies?

Several emerging technologies hold promise for developing novel CtrB-targeted antimicrobial strategies:

  • Structure-Based Drug Design Advancements:

    • Cryo-electron microscopy at near-atomic resolution is increasingly applicable to membrane proteins like CtrB.

    • AlphaFold and related AI protein structure prediction tools can generate structural models to guide drug design when experimental structures are unavailable.

    • Fragment-based drug discovery allows identification of small molecules that bind to specific pockets within membrane proteins.

  • High-Throughput Screening Innovations:

    • Microfluidic platforms for rapid assessment of compound libraries against CtrB function.

    • Cell-free expression systems coupled with functional assays for screening inhibitors without cellular complexity.

    • CRISPR-based screening to identify synthetic lethal interactions with CtrB, revealing potential combination therapy targets.

  • Precision Targeting Approaches:

    • Nanobodies (single-domain antibodies) that can recognize specific epitopes of membrane proteins like CtrB with high specificity.

    • Peptide inhibitors designed to disrupt specific protein-protein interactions within the capsule export machinery.

    • RNA-based therapeutics (antisense oligonucleotides or siRNA) to down-regulate ctrB expression.

  • Advanced Delivery Systems:

    • Bacteriophage-based delivery of CRISPR-Cas systems targeting the ctrB gene.

    • Nanoparticle formulations designed to penetrate the outer membrane and deliver CtrB inhibitors.

    • Membrane-fusion peptides that can carry cargo directly to the inner membrane.

  • Combination Strategy Platforms:

    • Systems for co-targeting multiple components of the capsule export pathway simultaneously.

    • Dual-action molecules that inhibit both capsule biosynthesis and export.

    • Antivirulence approaches combining CtrB inhibition with targeting of other virulence factors like TbpA/TbpB .

  • Innovative Vaccination Strategies:

    • Reverse vaccinology 2.0 approaches incorporating structural vaccinology principles to design optimal CtrB epitopes.

    • mRNA vaccine platforms for delivery of CtrB antigen-encoding sequences.

    • Outer membrane vesicle (OMV) vaccines engineered to present CtrB epitopes, building on established OMV vaccine approaches .

These emerging technologies could overcome traditional barriers to targeting inner membrane proteins, potentially unlocking new therapeutic strategies against meningococcal disease that are less susceptible to resistance development and capsule switching mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.