Recombinant Neisseria meningitidis serogroup B Capsule polysaccharide export inner-membrane protein CtrC (ctrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ctrC; NMB0073; Capsule polysaccharide export inner-membrane protein CtrC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
ctrC
Target Protein Sequence
MKALHKTSFWESLAIQRRVIGALLMREIITRYGRNNIGFLWLFVEPLLMTFVIVLMWKFL RADRYSTLNIVAFAITGYPMLMMWRNASKRAVGSISSNASLLYHRNVRVLDTILARMILE IAGATIAQIVIMAVLIAIGWIEMPADMFYMLMAWLLMAFFAIGLGLVICSIAFNFEPFGK IWGTLTFVMMPLSGAFFFVHNLPPKVQEYALMIPMVHGTEMFRAGYFGSDVITYENPWYI VLCNLVLLLFGLAMVSKFSKGVEPQ
Uniprot No.

Target Background

Function
CtrC is involved in the formation of an ATP-driven capsule polysaccharide export apparatus, working in conjunction with CtrB and CtrD proteins.
Database Links

KEGG: nme:NMB0073

STRING: 122586.NMB0073

Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of CtrC in N. meningitidis capsule biosynthesis?

CtrC functions as a component of an ABC transporter system in N. meningitidis, working together with CtrD to form a complete transporter. This system is essential for the export of polysialic acid (PSA) to the bacterial surface. CtrC and CtrD operate alongside CtrA and CtrB proteins, which form a cell envelope-spanning export complex necessary for capsular polysaccharide translocation . The entire system facilitates the movement of capsular polysaccharides from the cytoplasm to the cell surface, which is critical for virulence and survival of the pathogen.

How does the CtrC-containing transport system compare to similar systems in other bacteria?

The CtrC-CtrD ABC transporter system in N. meningitidis functions similarly to related systems in other encapsulated bacteria, particularly those with group 2 capsule assembly pathways. In E. coli, comparable systems have been well-characterized, with distinct groups (1-4) of capsule assembly strategies identified . The fundamental difference between these systems lies in the specific proteins involved and their organization, but they share the core function of polysaccharide export. While E. coli employs proteins like Wzc (a tyrosine autokinase) in some capsule systems, N. meningitidis utilizes the CtrA-D system for its capsular export machinery .

What experimental approaches are most effective for studying CtrC function?

To effectively study CtrC function, researchers should implement:

  • Recombinant expression systems: Cloning and expressing the ctrC gene in E. coli similar to approaches used for TbpA/B proteins .

  • Complementation assays: Using cross-complementation with related PCP and OPX proteins from other bacteria to determine functional conservation and interaction specificity .

  • Structural characterization: Applying techniques such as cryo-electron microscopy that have been successful with the related CtrB protein .

  • Functional assays: Developing systems to measure polysaccharide transport efficiency, potentially using radiolabeled or fluorescently tagged polysaccharides to track movement across membranes.

  • Mutagenesis studies: Creating targeted mutations to identify critical functional domains, following models used in other membrane transport proteins.

What are the optimal conditions for recombinant expression of CtrC?

For optimal recombinant expression of CtrC:

  • Expression system selection: E. coli BL21(DE3) or similar strains designed for membrane protein expression are recommended. Expression systems that have successfully produced other N. meningitidis membrane proteins like TbpA can be adapted for CtrC .

  • Vector optimization: Vectors containing T7 promoters with tunable expression (like pET systems) allow controlled expression levels to prevent toxicity.

  • Induction parameters:

    • Temperature: 16-20°C for overnight expression to reduce inclusion body formation

    • IPTG concentration: 0.1-0.5 mM, determined through optimization experiments

    • Growth phase: Induction at mid-log phase (OD600 = 0.6-0.8)

  • Media supplementation: Addition of glucose (0.5-1%) during growth and glycerol (10%) during induction can improve membrane protein folding.

  • Codon optimization: Adapting the ctrC gene sequence for E. coli codon usage may significantly increase expression levels.

What purification strategies yield the highest purity and activity of recombinant CtrC?

Effective purification strategies for recombinant CtrC should include:

  • Membrane preparation: Careful cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent selection: Screening of detergents (DDM, LDAO, Triton X-100) for optimal solubilization while maintaining protein activity.

  • Affinity chromatography: Utilizing histidine or other affinity tags for initial purification, similar to techniques used for TbpA/B proteins .

  • Size exclusion chromatography: For final polishing and buffer exchange into stabilizing formulations.

  • Functional validation: Confirming activity through ATP hydrolysis assays or partner protein binding studies to ensure the purified protein retains functionality.

How can researchers verify the correct folding and functionality of purified CtrC?

To verify correct folding and functionality of purified CtrC:

  • Circular dichroism (CD) spectroscopy: Assess secondary structure composition to confirm proper folding.

  • ATP hydrolysis assays: Measure ATPase activity as CtrC functions as part of an ABC transporter system.

  • Partner protein interaction studies: Confirm binding to CtrD, CtrA, and CtrB using pull-down assays or surface plasmon resonance.

  • Reconstitution experiments: Incorporate purified CtrC into liposomes or nanodiscs and measure transport activity.

  • Thermal shift assays: Evaluate protein stability under different buffer conditions to optimize storage and functional studies.

What structural features of CtrC are critical for its function in capsular polysaccharide export?

The critical structural features of CtrC include:

  • ATP-binding domains: As part of an ABC transporter, CtrC contains nucleotide-binding domains that hydrolyze ATP to power transport.

  • Transmembrane domains: These hydrophobic regions anchor the protein in the inner membrane and form the channel through which substrates pass.

  • Interaction interfaces: Specific regions that mediate binding to CtrD to form a complete ABC transporter, and potentially interfaces with CtrB and other export machinery components .

  • Substrate binding sites: Domains that recognize the capsular polysaccharide or intermediates for transport.

  • Conserved motifs: Walker A and B motifs, signature motifs, and D-loops typical of ABC transporters that are essential for nucleotide binding and hydrolysis.

How does CtrC interact with other components of the capsular export machinery?

CtrC forms a functional export system through:

  • CtrC-CtrD interaction: CtrC partners with CtrD to form a complete ABC transporter, with both proteins contributing to ATP binding and hydrolysis functions .

  • CtrC/D-CtrB interface: The ABC transporter likely interfaces with CtrB, an inner membrane polysaccharide co-polymerase (PCP) protein that forms a conical structure extending ~125 Å from the membrane .

  • Complete transport complex: CtrC/D and CtrB interact with CtrA (an outer membrane polysaccharide export protein) to form a cell envelope-spanning complex that facilitates polysaccharide movement from cytoplasm to cell surface .

  • Specificity of interactions: Research indicates that PCP-OPX pairs (like CtrB-CtrA) require cognate partner interactions for functional polysaccharide export, suggesting specific recognition regions between components .

  • Spatial organization: The ABC transporter components are arranged to create a continuous pathway for polysaccharide movement across the bacterial cell envelope.

What advanced imaging techniques have been successfully applied to study CtrC and related transport proteins?

Advanced imaging techniques used to study CtrC and related proteins include:

  • Cryo-electron microscopy: Successfully used to visualize purified CtrB reconstituted into lipid bilayers, showing its conical oligomeric structure extending from the membrane . Similar approaches could be applied to CtrC or the complete transport complex.

  • Single-particle analysis: For determining the three-dimensional structure of purified protein complexes.

  • X-ray crystallography: While challenging for membrane proteins, this technique has been applied to related ABC transporters to reveal high-resolution structures.

  • Electron tomography: To visualize the capsule export machinery in situ within bacterial cells.

  • Super-resolution fluorescence microscopy: For tracking the localization and dynamics of fluorescently labeled CtrC in living bacteria.

What are the most effective methods for generating ctrC mutants to study protein function?

Effective methods for generating ctrC mutants include:

  • Site-directed mutagenesis: Targeting conserved motifs (Walker A/B, signature motifs) to disrupt ATP binding/hydrolysis.

  • Domain swapping: Exchanging domains between CtrC and homologous ABC transporters to identify specificity determinants.

  • Deletion analysis: Creating truncated versions of CtrC to map functional domains.

  • Random mutagenesis: Using error-prone PCR followed by functional screening to identify novel functional residues.

  • CRISPR-Cas9 genome editing: For generating mutations directly in the N. meningitidis chromosome to study effects in the native context.

What phenotypic assays best measure CtrC function in both laboratory and clinical isolates?

The most informative phenotypic assays include:

  • Capsule quantification: Measuring surface polysaccharide levels using antibody-based techniques or specific staining methods.

  • Electron microscopy: Visualizing capsule thickness and morphology in wild-type versus mutant strains.

  • Serum resistance assays: Testing bacterial survival in human serum, as the capsule provides protection against complement-mediated killing.

  • Adhesion and invasion assays: Measuring interaction with host cells, which is often modulated by capsular polysaccharides.

  • Animal infection models: Evaluating virulence in appropriate animal models, similar to those used for TbpA/B vaccine studies .

How does CtrC compare to other N. meningitidis proteins as a potential vaccine target?

CtrC as a vaccine target compared to other meningococcal proteins:

  • Conservation across strains: Unlike some surface antigens that show high variability (like TbpB), inner membrane proteins like CtrC may be more conserved across strains .

  • Accessibility to antibodies: As an inner membrane protein, CtrC presents challenges for antibody access compared to outer membrane proteins like TbpA and TbpB .

  • Functional significance: Disruption of CtrC function could potentially inhibit capsule formation, reducing bacterial virulence, though this differs from the direct bactericidal effect observed with TbpA/B antibodies .

  • Combination potential: CtrC could potentially be used in combination with other antigens like TbpA, which has shown protection against multiple meningococcal strains .

  • Conformational considerations: Similar to TbpA, antibody recognition of CtrC would likely be conformation-dependent, requiring careful antigen preparation .

What experimental approaches can determine whether antibodies against CtrC provide protection in animal models?

To evaluate protective potential of anti-CtrC antibodies:

  • Recombinant protein immunization: Purify properly folded recombinant CtrC and use as an immunogen in animal models, similar to approaches used with TbpA/B .

  • Challenge studies: Immunize mice or other animal models and challenge with live meningococci to assess protection, using established intraperitoneal infection models .

  • Bactericidal assays: Test serum from immunized animals for bactericidal activity against diverse meningococcal strains .

  • Cross-reactivity analysis: Evaluate whether antibodies recognize CtrC from different meningococcal strains to predict broad protection potential.

  • Passive immunization: Transfer purified anti-CtrC antibodies to naïve animals before challenge to determine direct protective effects.

How can researchers address the challenge of CtrC being less accessible to antibodies than surface-exposed proteins?

Strategies to address the limited accessibility of CtrC include:

  • Epitope mapping: Identify any regions of CtrC that might be transiently exposed during protein function.

  • Fusion constructs: Creating chimeric proteins that present CtrC epitopes on surface-exposed scaffold proteins.

  • Multi-component approach: Combining CtrC with surface-exposed antigens like TbpA that have demonstrated protection .

  • Alternative immune mechanisms: Focusing on T-cell responses rather than antibody-mediated protection.

  • Small molecule inhibitors: Developing compounds that target CtrC function as an alternative to antibody-based approaches.

What techniques can resolve the dynamic conformational changes in CtrC during the polysaccharide export process?

Advanced techniques to study CtrC dynamics include:

  • Single-molecule FRET: Introducing fluorescent labels at key positions to monitor distance changes during function.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions that undergo conformational changes during the transport cycle.

  • Electron paramagnetic resonance (EPR) spectroscopy: Using spin labels to measure distances between specific residues during different stages of transport.

  • Time-resolved cryo-EM: Capturing different conformational states by rapid freezing at different stages of the transport process.

  • Molecular dynamics simulations: Computational modeling of protein dynamics based on structural data to predict conformational changes.

How do post-translational modifications affect CtrC function in the capsule export process?

Investigating post-translational modifications of CtrC:

  • Phosphorylation analysis: Mass spectrometry to identify potential phosphorylation sites, particularly relevant given the role of tyrosine phosphorylation in related systems like Wzc in E. coli .

  • Site-directed mutagenesis: Creating phosphomimetic mutations (e.g., Ser/Thr/Tyr to Asp/Glu) to study the effects of constitutive phosphorylation.

  • In vitro modification: Using purified kinases to phosphorylate CtrC and measure changes in ATPase activity or partner protein interactions.

  • Inhibitor studies: Using kinase or phosphatase inhibitors to modulate CtrC phosphorylation state in vivo and measure effects on capsule production.

  • Comparative analysis: Examining conservation of potential modification sites across bacterial species that utilize similar export systems.

What are the energy requirements and ATP hydrolysis kinetics of CtrC during capsular polysaccharide export?

To characterize the energetics of CtrC function:

  • ATPase activity assays: Measuring ATP hydrolysis rates of purified CtrC alone and in complex with CtrD under various conditions.

  • Nucleotide binding studies: Using fluorescent ATP analogs or isothermal titration calorimetry to determine binding affinities and stoichiometry.

  • Coupled transport assays: Developing systems to measure polysaccharide transport coupled to ATP hydrolysis in reconstituted proteoliposomes.

  • Mutational analysis: Creating mutations in ATP-binding motifs to establish the relationship between ATP hydrolysis and transport activity.

  • Inhibitor studies: Using ATP analogs or other inhibitors to disrupt specific steps in the ATP hydrolysis cycle and determine rate-limiting steps.

What are the key considerations when designing experiments to study CtrC-CtrD interactions?

Critical considerations include:

  • Protein stability: Ensuring both proteins remain stable and correctly folded during interaction studies by optimizing buffer conditions.

  • Detergent selection: Identifying detergents that maintain protein activity while allowing protein-protein interactions.

  • Tagged versus untagged proteins: Determining whether affinity tags interfere with complex formation.

  • Stoichiometry analysis: Methods to determine the correct CtrC:CtrD ratio in functional complexes.

  • Functional reconstitution: Developing assays to confirm that purified complexes retain transport activity when reconstituted into membrane mimetics.

How can researchers establish reliable in vitro systems to study capsular polysaccharide export?

Creating reliable in vitro systems requires:

  • Membrane mimetic selection: Testing various systems (liposomes, nanodiscs, supported bilayers) to identify optimal platforms for reconstitution.

  • Component purification: Developing protocols to obtain all necessary components (CtrA, CtrB, CtrC, CtrD) in functional form.

  • Transport substrate preparation: Generating labeled or otherwise detectable capsular polysaccharide precursors.

  • Assembly verification: Using techniques like cryo-EM to confirm proper assembly of the transport complex in the membrane mimetic .

  • Quantitative assays: Developing methods to measure transport rates under varying conditions (ATP concentration, pH, ionic strength).

What controls and validation methods are essential when interpreting results from CtrC functional studies?

Essential controls and validation methods include:

  • Negative controls:

    • ATP-binding mutants (e.g., Walker A mutants) to confirm ATP dependence

    • Heat-inactivated protein preparations

    • Unrelated membrane proteins reconstituted under identical conditions

  • Positive controls:

    • Well-characterized ABC transporters studied under parallel conditions

    • Native membrane preparations containing intact export machinery

  • Validation approaches:

    • Multiple complementary techniques to measure the same parameter

    • Correlation of in vitro findings with in vivo phenotypes

    • Cross-validation in different expression systems or bacterial strains

  • Data integrity checks:

    • Reproducibility across multiple protein preparations

    • Dose-dependency of effects

    • Kinetic analysis to ensure measurements are made in the linear range

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.