Recombinant Neisseria meningitidis serogroup B Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Function and Biological Role

PlsY is a membrane-associated enzyme critical for phospholipid biosynthesis. It catalyzes the first step in glycerolipid formation, converting glycerol-3-phosphate and acyl-phosphate to lysophosphatidic acid, a precursor for membrane lipids . In N. meningitidis, phospholipids are essential for maintaining membrane integrity and facilitating interactions with host cells during infection.

Recombinant Production and Applications

Recombinant PlsY from serogroups A and C is produced in E. coli with an N-terminal His tag for purification. Key characteristics include:

  • Expression: High-yield soluble expression under optimized conditions .

  • Functionality: Retains enzymatic activity in vitro, confirmed by acyltransferase assays .

  • Potential Use: Serves as a tool for studying lipid metabolism in Neisseria and screening antimicrobial agents targeting membrane biosynthesis.

Notably, MenB’s lipid metabolism relies on alternative pathways, possibly involving exogenous fatty acid uptake or non-PlsY acyltransferases .

Research Implications and Gaps

  • MenB-Specific Challenges: The apparent absence of plsY in MenB raises questions about compensatory mechanisms for phospholipid synthesis. This gap highlights the need for deeper genomic and proteomic analyses of MenB strains .

  • Vaccine Development: While PlsY is not a component of current MenB vaccines (e.g., Bexsero, Trumenba), understanding lipid biosynthesis could inform novel therapeutic strategies .

Future Directions

  • Functional Studies: Heterologous expression of MenB homologs (if identified) in E. coli to confirm enzymatic activity.

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve PlsY’s catalytic mechanism across serogroups.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY; NMB1062; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
plsY
Target Protein Sequence
MFNIPAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGATNVLRSGKKKAAALTLLGD AAKGLVAVLLARVLQEPLGLSDSAIAAVALAALVGHMWPVFFGFKGGKGVATALGVLLAL SPATALVCALIWLVMAFGFKVSSLAALTATIAAPVAASFFMPHVSWVWATVAIALLVLFR HKSNIVKLLEGRESKIGGSR
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.

Database Links

KEGG: nme:NMB1062

STRING: 122586.NMB1062

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.