Recombinant Neisseria meningitidis serogroup B Na (+)-translocating NADH-quinone reductase subunit C (nqrC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a particular tag, please specify this in your order for preferential development.
Synonyms
nqrC; NMB0567; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
nqrC
Target Protein Sequence
MAKKFDKDSFSGTLIVVLAVSLICSVIVAGAVVGLKPIQEKQKLQDKQGYILSVAGLMDK DTDIGKTFAERIEQRVVDLATGEYVADAPKDFSARIAGKDPAQSIRIKTEDDLAGIKSRA KYTEVYLVKGEDGKIGQIILPMHGNGLWSVMYGFVAIQPDGNTINGITYYEQGETPGLGG EIGNPLWQQKFVGKKLFDGQGKLALHVGKGAGSDKEHGVDALSGASLTSKGVQGSFAYWF GENGYIPYLNKLKSAGAQ
Uniprot No.

Target Background

Function

The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE proteins are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: nme:NMB0567

STRING: 122586.NMB0567

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of Na(+)-translocating NADH-quinone reductase in Neisseria meningitidis metabolism?

The Na(+)-translocating NADH-quinone reductase (NQR) complex serves as a critical component in the respiratory chain of N. meningitidis, facilitating energy generation through the establishment of sodium gradients across the cell membrane. Unlike conventional NADH dehydrogenases, the NQR complex couples electron transfer from NADH to quinones with the translocation of sodium ions rather than protons, allowing N. meningitidis to maintain energy production under various environmental conditions . This unique adaptation contributes to the pathogen's ability to colonize different host niches with varying oxygen availability, as it facilitates ATP synthesis while maintaining redox balance.

What structural features distinguish nqrC from other subunits in the NQR complex?

The nqrC subunit possesses distinct structural domains that separate it from other components of the NQR complex. Based on structural analyses of homologous proteins, nqrC likely contains:

  • An N-terminal transmembrane domain that anchors it to the membrane

  • A flavin-binding domain that coordinates the FMN cofactor

  • A substrate-binding pocket that accommodates quinones

  • Specialized interface regions that facilitate interactions with nqrB and nqrD

These structural features enable nqrC to participate in electron transfer while maintaining specific protein-protein interactions necessary for complex assembly and function. Unlike other NQR subunits, nqrC's structure is optimized for intermediate electron transfer steps rather than for initial NADH binding or terminal quinone reduction .

What expression systems yield optimal functional activity for recombinant N. meningitidis nqrC?

When expressing recombinant N. meningitidis nqrC, researchers must carefully select expression systems that preserve the native conformation and cofactor incorporation. Based on studies with similar respiratory chain components, the following expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsYield (mg/L culture)Functional Activity (%)
E. coli BL21(DE3)High yield, simple protocolPotential improper folding5-860-75
E. coli C43(DE3)Better membrane protein foldingLower yield3-580-90
Cell-free systemsRapid productionExpensive, lower yield1-285-95
Neisseria speciesNative environmentComplex media, low yield0.5-195-100

The optimal approach involves using E. coli C43(DE3) with induction at lower temperatures (16-18°C) over an extended period (18-24 hours), which balances acceptable yield with proper folding and cofactor incorporation. Supplementation with riboflavin and iron compounds during expression significantly improves functional activity by ensuring proper FMN incorporation into the recombinant protein.

How can researchers distinguish between direct and indirect effects when analyzing nqrC mutations on bacterial virulence?

Distinguishing direct from indirect effects of nqrC mutations on N. meningitidis virulence requires a multi-faceted experimental approach:

  • Complementation studies: Generate nqrC deletion mutants complemented with either wild-type or site-directed mutant versions of nqrC to establish causality.

  • Metabolic flux analysis: Apply 13C-labeling and NMR spectroscopy to track changes in central carbon metabolism resulting from nqrC mutations .

  • Transcriptomic profiling: Assess global gene expression changes to identify compensatory responses that may confound virulence phenotypes.

  • In vitro versus in vivo comparison: Test mutant strains in both defined media and infection models to differentiate growth defects from virulence attenuation.

  • Biochemical assays: Directly measure NQR complex activity in membrane preparations to correlate enzymatic function with observed phenotypes.

This integrated approach allows researchers to determine whether observed virulence defects result directly from altered respiratory function or indirectly through metabolic adaptations that influence other virulence determinants.

What are the optimal parameters for assessing recombinant nqrC enzymatic activity?

Accurate assessment of recombinant nqrC enzymatic activity requires careful optimization of assay conditions:

Recommended Assay Conditions:

  • Buffer composition: 50 mM HEPES-KOH (pH 7.5), 100 mM NaCl, 5 mM MgCl2

  • Temperature: 30°C (reflect physiological conditions)

  • Substrates: NADH (0.2-0.5 mM), ubiquinone-1 (0.1 mM)

  • Detection methods: Spectrophotometric monitoring of NADH oxidation (340 nm) or quinone reduction (275 nm)

Critical Considerations:

  • Include proper controls to account for non-enzymatic NADH oxidation

  • Maintain anaerobic conditions when necessary to prevent auto-oxidation

  • Test activity across a range of sodium concentrations (0-200 mM) to confirm Na+-dependence

  • Incorporate membrane fractions or phospholipids to provide a native-like environment for the membrane-bound enzyme

For complex kinetic analyses, researchers should employ both steady-state and pre-steady-state measurements to fully characterize electron transfer rates between nqrC and its neighboring subunits. This approach enables distinction between rate-limiting steps and identification of key catalytic residues.

How should researchers design comparative analyses between NQR complexes from different bacterial species?

When conducting comparative analyses between NQR complexes from different bacterial species, researchers should employ a systematic approach that accounts for both structural and functional variations:

  • Sequence-structure-function correlation:

    • Perform comprehensive sequence alignments of nqrC and other subunits

    • Generate homology models based on available crystal structures

    • Identify conserved residues and species-specific variations in cofactor binding sites

  • Experimental design considerations:

    • Use standardized expression systems for all species being compared

    • Normalize enzyme concentrations based on active site titration rather than total protein

    • Employ identical assay conditions, adjusting only species-specific parameters (e.g., temperature optima)

  • Parameters for comparison:

ParameterMeasurement MethodExpected Variation Range
Electron transfer rateStopped-flow spectroscopy10-1000 s-1
Na+ binding affinityIsothermal titration calorimetryKd = 0.1-10 mM
Quinone specificitySubstrate competition assaysVariable based on native quinones
ThermostabilityDifferential scanning fluorimetryTm variation of 5-25°C

What protocols can reliably differentiate between quinone reductase activity and NADH dehydrogenase activity in purified nqrC preparations?

Differentiating between quinone reductase and NADH dehydrogenase activities requires selective inhibition and substrate variation approaches:

Protocol for Activity Differentiation:

  • Selective inhibition:

    • Use 2-heptyl-4-hydroxyquinoline N-oxide (HQNO, 5-10 μM) to specifically inhibit NQR activity

    • Apply rotenone (5 μM) to selectively inhibit NDH-type NADH dehydrogenases

    • Employ silver ions (Ag+, 1-5 μM) as specific NQR inhibitors that interact with nqrC

  • Substrate specificity testing:

    • Compare activity with physiological quinones (ubiquinone) versus artificial electron acceptors (ferricyanide)

    • Assess Na+-dependence by comparing activity in Na+-free versus Na+-containing buffers

    • Determine pH dependence profiles (NQR shows distinct pH optima compared to NDH)

  • Spectroscopic differentiation:

    • Monitor flavin reduction kinetics, as NQR complexes display characteristic spectral shifts

    • Employ EPR spectroscopy to identify specific paramagnetic intermediates unique to the NQR reaction mechanism

By implementing this comprehensive approach, researchers can accurately attribute measured activities to nqrC within the NQR complex versus contaminating NADH dehydrogenases that may co-purify with the target protein.

What strategies effectively overcome the challenges of expressing membrane-integrated subunits like nqrC for structural studies?

Expressing membrane-integrated proteins like nqrC for structural studies presents significant challenges that can be addressed through targeted strategies:

  • Expression system optimization:

    • Use specialized E. coli strains (C41/C43) engineered for membrane protein expression

    • Employ inducible systems with tunable expression levels to prevent toxicity

    • Consider Neisseria-based expression systems for native lipid environment

  • Construct design considerations:

    • Generate fusion proteins with solubilizing partners (MBP, SUMO)

    • Create truncation constructs that maintain core functional domains

    • Incorporate stabilizing mutations identified through alanine scanning

  • Purification approaches:

    • Select appropriate detergents through systematic screening (DDM, LMNG, GDN)

    • Implement on-column detergent exchange during purification

    • Consider nanodiscs or SMALPs for near-native membrane environments

  • Stability enhancement for structural studies:

    • Screen lipid additives that stabilize the protein

    • Identify stabilizing ligands through thermal shift assays

    • Apply conformational fixation through engineered disulfide bonds

For cryo-EM studies specifically, researchers should focus on generating larger constructs that include multiple NQR subunits to increase particle size and enable better orientation determination during image processing . For crystallography, implementing surface entropy reduction mutations can enhance crystallizability while maintaining native function.

How should researchers interpret metabolomic data to understand the impact of nqrC mutations on Neisseria meningitidis cellular metabolism?

Interpreting metabolomic data for nqrC mutants requires a systematic analytical approach that distinguishes direct metabolic consequences from compensatory responses:

  • Primary analytical framework:

    • Focus initial analysis on NAD+/NADH ratios as direct indicators of altered electron transport

    • Examine changes in TCA cycle intermediates and amino acid pools that reflect altered carbon flux

    • Monitor quinone/quinol ratios as indicators of respiratory chain function

  • Integrated data analysis approach:

    • Apply principal component analysis to identify metabolic patterns distinguishing mutant from wild-type

    • Use pathway enrichment analysis to identify significantly impacted metabolic modules

    • Implement flux balance analysis to model system-wide effects of specific enzymatic changes

  • Distinguishing direct from indirect effects:

    • Compare metabolic profiles under different growth conditions (aerobic, microaerobic, with/without alternative electron acceptors)

    • Examine time-course metabolomic data to separate immediate consequences from adaptive responses

    • Correlate metabolite changes with transcriptomic data to identify regulatory responses

When analyzing complex metabolomic datasets, researchers should pay particular attention to:

Metabolite ClassExpected Direct EffectsPotential Compensatory Responses
Reducing equivalentsAltered NAD+/NADH ratioInduction of alternative dehydrogenases
Central carbon intermediatesPyruvate accumulationIncreased flux through glycolysis
Amino acidsChanges in glutamate familyUpregulation of amino acid catabolism
Energy carriersDecreased ATP/ADP ratioActivation of substrate-level phosphorylation

This structured approach enables researchers to develop mechanistic models explaining how nqrC function influences broader cellular metabolism and virulence capabilities in N. meningitidis.

What parametric analysis approaches best characterize the electron transfer kinetics in reconstituted NQR complexes containing recombinant nqrC?

Parametric analysis of electron transfer kinetics in NQR complexes requires specialized approaches that can distinguish between sequential electron transfer steps:

The most informative parametric analyses for NQR complexes examine how the rate constants for individual electron transfer steps respond to changes in experimental variables. This approach allows researchers to develop detailed mechanistic models that explain how nqrC and other subunits coordinate electron and sodium ion movements.

What novel approaches could advance our understanding of nqrC's role in meningococcal adaptation to host environments?

Several innovative research approaches could significantly advance our understanding of nqrC's role in host adaptation:

  • Advanced Imaging Techniques:

    • Implement single-molecule FRET to track conformational changes during the catalytic cycle

    • Apply super-resolution microscopy to examine NQR complex distribution in the meningococcal membrane during infection

    • Develop fluorescent sensors for sodium flux to correlate NQR activity with ion movement

  • Genetic Approaches:

    • Generate conditional knockdowns to study nqrC essentiality under different host conditions

    • Apply CRISPR interference for temporal control of nqrC expression during infection

    • Create reporter strains linking nqrC activity to fluorescent protein expression

  • Infection Models:

    • Develop ex vivo nasopharyngeal tissue models to study NQR function during colonization

    • Implement oxygen-controlled infection systems to mimic host microenvironments

    • Use intravital imaging to track metabolic activity of nqrC mutants during infection

  • Systems Biology Integration:

    • Combine transcriptomics, proteomics, and metabolomics data using multi-omics integration

    • Develop host-pathogen interaction models that incorporate metabolic exchange

    • Apply machine learning to identify patterns linking nqrC function to virulence phenotypes

These approaches would help elucidate how N. meningitidis uses the NQR complex to adapt its energy metabolism to the changing conditions encountered during colonization and invasion, potentially revealing new targets for antimicrobial development.

How might structural data from recombinant nqrC inform the development of selective inhibitors targeting meningococcal bioenergetics?

Structural data from recombinant nqrC could enable rational design of selective inhibitors through the following approaches:

  • Structure-based design pipeline:

    • Identify nqrC-specific binding pockets distinct from human respiratory complexes

    • Focus on regions involved in quinone binding or sodium translocation

    • Target interface regions between nqrC and other NQR subunits

  • Computational methods:

    • Employ molecular dynamics simulations to identify transient binding pockets

    • Use virtual screening against libraries of drug-like compounds

    • Implement fragment-based approaches to develop high-affinity inhibitors

  • Experimental validation:

    • Develop medium-throughput assays for NQR inhibition suitable for compound libraries

    • Establish structure-activity relationships through systematic chemical modifications

    • Validate selectivity against human respiratory complexes

  • Translational considerations:

    • Ensure inhibitors can penetrate the meningococcal outer membrane

    • Optimize pharmacokinetic properties for potential therapeutic applications

    • Test for activity against diverse clinical isolates to ensure broad coverage

This structure-guided approach could yield inhibitors that selectively target meningococcal bioenergetics, potentially providing new therapeutic options for meningococcal infections that circumvent traditional resistance mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.