Recombinant Neisseria meningitidis serogroup B Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Neisseria meningitidis serogroup B Na(+)-translocating NADH-quinone reductase subunit E (nqrE)

Recombinant Neisseria meningitidis serogroup B Na(+)-translocating NADH-quinone reductase subunit E (nqrE) is a protein component of the Na(+)-translocating NADH:ubiquinone oxidoreductase (Na+-NQR) complex. This complex plays a crucial role in the respiratory chain of certain bacteria, including Neisseria meningitidis, by facilitating the reduction of ubiquinone to ubiquinol while translocating sodium ions across the cell membrane .

Function and Mechanism

The Na+-NQR complex is analogous to the proton-pumping Complex I in the mitochondrial respiratory chain but uses sodium ions instead of protons. It consists of several subunits, with nqrE being one of the integral membrane components. The complex utilizes the energy from NADH oxidation to expel sodium ions from the cytoplasm, generating a sodium motive force (SMF) that contributes to the cell's energy metabolism .

Key Features of Na+-NQR Complex:

  • Subunits: The complex includes subunits like nqrA, nqrB, nqrC, nqrD, nqrE, and nqrF.

  • Function: Oxidizes NADH and reduces ubiquinone while translocating sodium ions.

  • Mechanism: Uses the energy from redox reactions to pump sodium ions across the membrane.

Structure and Subunit Interactions

Subunits nqrD and nqrE are homologous and form a core part of the membrane-bound segment of the Na+-NQR complex. They are arranged symmetrically in the membrane, contributing to the formation of novel binding sites for iron atoms, which are crucial for the enzyme's redox activity .

Recombinant Production and Applications

Recombinant nqrE proteins are produced using expression systems like E. coli. These proteins are often used in research to study the biochemical properties of the Na+-NQR complex and its role in bacterial metabolism. They can also serve as antigens in immunological studies or as tools for developing diagnostic assays .

Research Findings and Implications

Research on the Na+-NQR complex and its subunits like nqrE has provided insights into the unique mechanisms of sodium-dependent respiration in bacteria. This knowledge can contribute to understanding bacterial pathogenesis and developing novel therapeutic strategies targeting bacterial respiratory chains .

Recent Research Highlights:

  • Sodium Dependence: The quinone reductase activity of Na+-NQR is highly dependent on sodium ions, with added Na+ significantly enhancing enzyme activity .

  • Cation Binding: The complex can bind multiple cations, including sodium and lithium, with distinct affinities and effects on enzyme activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; NMB0565; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
nqrE
Target Protein Sequence
MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVY SLLKDGAIAEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCA IFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFI AAGLMAMAFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: nme:NMB0565

STRING: 122586.NMB0565

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase subunit E (nqrE) and what role does it play in N. meningitidis metabolism?

Na(+)-translocating NADH-quinone reductase subunit E (nqrE) is an integral membrane component of the Na+-NQR complex, a respiratory enzyme that couples NADH oxidation to sodium ion translocation across the bacterial membrane. This complex forms part of the electron transport chain in N. meningitidis and contributes to establishing electrochemical gradients essential for energy production. Unlike conventional H+-pumping respiratory complexes, the Na+-NQR system utilizes Na+ ions as coupling ions, which may represent an adaptation to specific environmental niches encountered during host colonization.

Methodologically, the function of nqrE can be investigated through:

  • Membrane vesicle preparation and sodium transport assays using fluorescent Na+ indicators

  • Oxygen consumption measurements in whole cells and membrane preparations

  • Comparison of growth kinetics between wild-type and nqrE deletion mutants under varying sodium concentrations

How should researchers express and purify recombinant nqrE protein for structural and functional studies?

Successful expression and purification of membrane proteins like nqrE requires careful optimization of conditions. Based on experience with similar proteins, researchers should consider:

Table 1: Expression Systems for Recombinant nqrE Production

The purification workflow should typically include:

  • Membrane isolation by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization with mild detergents (DDM, LMNG, or digitonin)

  • IMAC purification using His-tagged constructs

  • Size exclusion chromatography to improve purity and assess oligomeric state

  • Functional validation through activity assays

Researchers should monitor protein quality by SDS-PAGE, Western blotting, and circular dichroism to ensure proper folding before proceeding to functional or structural studies.

What approaches are most effective for studying the transmembrane topology of nqrE?

Understanding the membrane topology of nqrE is crucial for elucidating structure-function relationships. Effective approaches include:

  • Cysteine accessibility methods:

    • Introduction of single cysteine residues throughout the protein

    • Treatment with membrane-impermeable thiol-reactive reagents

    • Determination of accessibility pattern to map transmembrane segments

  • Fusion protein approaches:

    • Creation of truncated constructs fused to reporter proteins (GFP, PhoA, LacZ)

    • Analysis of reporter activity to determine cytoplasmic vs. periplasmic localization

  • Protease protection assays:

    • Treatment of membrane vesicles with proteases

    • Identification of protected fragments by mass spectrometry or immunoblotting

  • Computational prediction:

    • Use of multiple algorithms (TMHMM, MEMSAT, OCTOPUS)

    • Consensus prediction to improve accuracy

  • Structural techniques:

    • Cryo-electron microscopy of the complete Na+-NQR complex

    • X-ray crystallography of individual domains or stabilized proteins

Researchers should combine multiple approaches to develop a robust topological model before proceeding to detailed functional studies.

How does recombination affect the evolution of nqrE in N. meningitidis populations?

Recombination plays a critical role in the evolution of metabolic genes in N. meningitidis, including nqrE. Studies have shown that approximately 40% of meningococcal core genes are affected by recombination, primarily within metabolic genes and genes involved in DNA replication and repair . For nqrE and related components of respiratory complexes, this recombination can:

  • Introduce novel sequence variations affecting protein function

  • Spread adaptive mutations across different lineages

  • Create mosaic genes with segments derived from multiple genetic backgrounds

  • Contribute to the natural diversity of nqrE variants seen in clinical isolates

Research has demonstrated that recombination rates vary significantly between different lineages of N. meningitidis, with some lineages showing orders of magnitude higher recombination rates than others . This variation may affect how rapidly adaptive mutations in genes like nqrE can spread through populations.

Methodologically, researchers can investigate recombination in nqrE through:

  • Phylogenetic analysis of nqrE sequences from diverse isolates

  • Application of recombination detection algorithms (ClonalFrameML, Gubbins)

  • Comparison of nqrE gene trees with species phylogeny to identify incongruences

  • Experimental assessment of transformation frequencies using marked nqrE alleles

What is the relationship between nqrE function and meningococcal virulence?

While nqrE is primarily considered a metabolic gene, growing evidence suggests connections between energy metabolism and virulence in N. meningitidis. Several lines of evidence support this relationship:

  • Metabolic adaptation during infection: Differences in metabolism have been implicated in meningococcal virulence . The Na+-NQR complex may contribute to bacterial survival in different host niches by maintaining energy production under variable oxygen conditions.

  • Environmental sensing: The nqrE protein may contribute to the ability of meningococci to sense and respond to environmental changes encountered during infection.

  • Relationship with virulence islands: Genomic analyses have revealed associations between virulence and specific genetic elements in N. meningitidis . While nqrE itself is not located within known virulence islands, its expression or activity may be coordinated with virulence factor production.

Researchers can investigate these connections through:

How can site-directed mutagenesis of nqrE inform our understanding of Na+ transport mechanisms?

Site-directed mutagenesis represents a powerful approach to dissect the molecular mechanisms of ion transport by nqrE. A systematic mutagenesis strategy should include:

Table 2: Key Residues in nqrE for Site-Directed Mutagenesis Studies

Target CategoryRationaleRecommended MutationsExperimental Readout
Charged residues in transmembrane regionsPotential Na+ coordination sitesD→N, E→Q (neutralization)
D→K, E→R (charge reversal)
Na+ transport rates; ion selectivity
Conserved motifsFunctionally important sequencesAlanine scanning of conserved regionsComplex assembly; enzyme activity
Glycine residuesConformational flexibilityG→A, G→P (restrict flexibility)Transport kinetics; conformational changes
Interface residuesSubunit interactionsMutations based on structural predictionsComplex stability; co-purification efficiency
Quinone binding sitesElectron acceptor interactionY→F, Y→A (disrupt H-bonding)NADH oxidation activity

This approach provides insight into:

  • Residues directly involved in Na+ binding and translocation

  • Mechanisms of energy coupling between electron transfer and ion movement

  • Structural features essential for complex assembly and stability

  • Conformational changes associated with the transport cycle

Functional assessment of mutants should include measurement of Na+ transport rates, NADH oxidation activity, and proton translocation to distinguish specific effects on different aspects of protein function.

What impact do post-translational modifications have on nqrE function?

While bacterial membrane proteins are generally less extensively modified than their eukaryotic counterparts, emerging evidence suggests that post-translational modifications (PTMs) may play important regulatory roles in proteins like nqrE. Potential modifications include:

  • Phosphorylation: Serine, threonine, or tyrosine phosphorylation can regulate protein activity or interactions with other subunits

  • Acetylation: Lysine acetylation may affect protein stability or membrane localization

  • Glycosylation: Although less common in bacteria, some Neisseria proteins undergo glycosylation

  • Lipid modifications: May affect membrane domain localization

  • Oxidative modifications: Cysteine oxidation may serve as a redox sensor

Methodological approaches to investigate PTMs in nqrE include:

  • Mass spectrometry-based proteomics to identify and map modification sites

  • Mutagenesis of putative modification sites to mimic or prevent modifications

  • Expression in hosts with altered PTM machinery

  • In vitro modification assays using purified enzymes

  • Functional comparisons between native and modified protein forms

How does the nqrE gene in N. meningitidis serogroup B compare to that in other pathogenic Neisseria species?

Comparative analysis of nqrE across Neisseria species provides insights into evolutionary conservation and potential functional specialization. Key findings include:

Table 3: Comparison of nqrE Between Neisseria Species

SpeciesSequence Identity to N. meningitidis serogroup BKey DifferencesPotential Functional Implications
N. gonorrhoeae94-96%Variations in transmembrane domainsMay affect ion selectivity
N. lactamica88-91%Differences in cytoplasmic loopsCould impact interaction with other subunits
N. cinerea85-87%Higher variability in C-terminal regionPossible effects on substrate binding
N. sicca75-78%Multiple substitutions throughoutAdaptation to different ecological niches

Research approaches should include:

  • Phylogenetic analysis to determine evolutionary relationships

  • Homology modeling to predict structural consequences of sequence variations

  • Functional complementation studies to test interchangeability between species

  • Expression of heterologous nqrE proteins to compare biochemical properties

This comparative approach can reveal:

  • Conserved residues essential for basic function

  • Species-specific adaptations related to pathogenesis

  • Potential targets for species-specific inhibitors

  • Evolutionary pressures shaping nqrE sequence and function

What are the optimal conditions for measuring nqrE activity in membrane preparations?

Accurate measurement of nqrE activity requires careful preparation of membrane fractions and optimized assay conditions:

Membrane preparation protocol:

  • Harvest cells at mid-logarithmic phase (OD600 0.6-0.8)

  • Wash with buffer containing 50 mM Tris-HCl pH 7.5, 5 mM MgCl2

  • Disrupt cells by sonication or French press

  • Remove unbroken cells (5,000 × g, 10 min)

  • Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 5 mM MgCl2, 10% glycerol

Activity assay conditions:

  • Buffer: 50 mM Tris-HCl pH 7.5, 5 mM MgCl2, 50-200 mM NaCl

  • Temperature: 30-37°C (optimize for specific applications)

  • Electron donor: 0.1-0.5 mM NADH

  • Electron acceptor: 0.1 mM ubiquinone-1 or menadione

  • Monitoring methods:

    • Spectrophotometric measurement of NADH oxidation (340 nm)

    • Oxygen consumption using Clark-type electrode

    • Na+ transport using fluorescent indicators (SBFI)

Controls and validations:

  • Include specific inhibitors (HQNO, 2-n-heptyl-4-hydroxyquinoline N-oxide)

  • Perform assays with varying Na+ concentrations to demonstrate dependence

  • Use ionophores to dissipate Na+ gradients as negative controls

  • Compare activities in wild-type vs. nqrE-deficient membrane preparations

This methodological approach ensures reliable and reproducible assessment of nqrE activity in different experimental contexts.

What structural biology techniques are most promising for resolving the three-dimensional structure of nqrE?

Determining the structure of membrane proteins like nqrE presents significant challenges. The following techniques offer complementary approaches:

  • X-ray crystallography:

    • Requires detergent-solubilized or lipidic cubic phase crystallization

    • Challenges: obtaining well-diffracting crystals

    • Strategies: fusion partners (T4 lysozyme, BRIL), antibody fragments for crystallization

  • Cryo-electron microscopy:

    • Particularly suitable for the entire Na+-NQR complex

    • Approaches: detergent solubilization, nanodiscs, or amphipols

    • Resolution potentially reaching 3-4 Å for well-behaved samples

  • Nuclear magnetic resonance (NMR):

    • More suitable for individual domains or small membrane proteins

    • Options: solution NMR in detergent micelles or solid-state NMR in lipid bilayers

    • Can provide dynamic information not accessible by other methods

  • EPR spectroscopy:

    • Site-directed spin labeling to map distances between residues

    • Double electron-electron resonance (DEER) for measuring long-range distances

    • Complements other structural methods

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to predict ion pathways

    • Integration with experimental constraints from cross-linking or mutagenesis

Table 4: Comparison of Structural Biology Techniques for nqrE

TechniqueResolution PotentialProtein RequirementsAdvantagesLimitations
X-ray crystallography1.5-3 Å5-10 mg, highly pureHighest resolutionDifficult crystallization
Cryo-EM2.5-4 Å1-2 mg, homogeneousWorks with larger complexesLower resolution for smaller proteins
Solution NMRDomain-level0.5-1 mg, isotope-labeledDynamic informationSize limitations (~25 kDa)
Solid-state NMR3-4 Å5-10 mg, isotope-labeledNative-like environmentComplex data interpretation
EPR spectroscopyDistance constraints1-2 mg, spin-labeledSpecific distance measurementsNot a complete structure

A comprehensive structural biology approach would combine multiple techniques to overcome the limitations of each individual method.

How can researchers distinguish between direct effects on nqrE and indirect effects on other components of the Na+-NQR complex?

Distinguishing direct from indirect effects on nqrE function requires systematic experimental design and careful controls:

  • Complementation studies:

    • Express wild-type nqrE in nqrE deletion background

    • Compare with mutant variants to confirm phenotype is specifically due to nqrE

  • Subunit-specific assays:

    • Measure flavin content (FMN, FAD) associated with different subunits

    • Assess iron-sulfur cluster integrity in relevant subunits

    • Monitor individual electron transfer steps within the complex

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation to assess interactions between nqrE and other subunits

    • Crosslinking studies to map interaction interfaces

    • FRET-based approaches to monitor complex assembly in vivo

  • Reconstitution experiments:

    • Purify individual subunits and reconstitute in defined combinations

    • Add components sequentially to identify dependencies

    • Use heterologous expression systems to avoid contamination from native proteins

  • Structural integrity assessment:

    • Circular dichroism to monitor secondary structure

    • Thermal stability assays to detect destabilization

    • Limited proteolysis to probe conformational changes

By systematically applying these approaches, researchers can differentiate between direct effects on nqrE and broader impacts on complex assembly or function.

What bioinformatic approaches are most effective for analyzing the evolution and conservation of nqrE across Neisseria species?

Effective bioinformatic analysis of nqrE requires multiple complementary approaches:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment using MUSCLE, MAFFT, or T-Coffee

    • Maximum likelihood or Bayesian phylogenetic methods

    • Bootstrap analysis to assess confidence in branching patterns

  • Detection of selective pressure:

    • Calculation of dN/dS ratios to identify sites under positive or negative selection

    • Codon-based tests for selection (PAML, HyPhy)

    • Sliding window analysis to identify regions with different selective pressures

  • Recombination analysis:

    • Methods to detect intragenic recombination (RDP, GARD)

    • Calculation of recombination rates (r/m) across lineages

    • Identification of potential donor sequences and breakpoints

  • Structural mapping:

    • Mapping conservation scores onto predicted protein structures

    • Identification of co-evolving residues that may interact functionally

    • Prediction of functional sites based on sequence conservation patterns

  • Comparative genomic context:

    • Analysis of gene neighborhoods across species

    • Identification of conserved operonic structures

    • Detection of horizontal gene transfer events

These approaches can reveal important insights about the evolutionary constraints on nqrE and identify regions that may be functionally significant or subject to adaptive evolution.

How can recombinant nqrE be used to develop assays for screening potential inhibitors of Na+-NQR activity?

Development of screening assays using recombinant nqrE offers opportunities for identifying novel inhibitors with potential antimicrobial applications:

  • High-throughput activity assays:

    • Colorimetric or fluorometric detection of NADH oxidation

    • Oxygen consumption measurements in plate format

    • Fluorescent detection of Na+ transport using sodium-sensitive dyes

  • Binding assays:

    • Thermal shift assays to detect ligand binding

    • Surface plasmon resonance with immobilized nqrE

    • Microscale thermophoresis for solution-based binding measurements

  • Fragment-based screening:

    • NMR-based fragment screening

    • X-ray crystallography with fragment libraries

    • Mass spectrometry to detect fragment binding

  • Virtual screening:

    • Molecular docking to predicted binding pockets

    • Pharmacophore-based screening

    • Machine learning approaches based on known inhibitors

  • Whole-cell confirmation assays:

    • Growth inhibition assays in Na+-dependent conditions

    • Reporter strains to monitor effects on membrane potential

    • Competition assays with known Na+-NQR inhibitors

These screening approaches can identify compounds that specifically target nqrE or the Na+-NQR complex, potentially leading to new antimicrobial agents with novel mechanisms of action.

What are the methodological considerations for comparing nqrE sequences and functions across clinical isolates of N. meningitidis?

Systematic comparison of nqrE across clinical isolates requires careful methodological considerations:

  • Sampling strategy:

    • Include isolates from diverse geographic regions

    • Sample both invasive and carriage isolates

    • Ensure representation of major genetic lineages

    • Include temporally diverse samples to capture evolution

  • Sequencing approach:

    • Whole genome sequencing to capture genomic context

    • Deep sequencing to detect minority variants

    • Long-read sequencing to resolve repetitive regions

  • Functional characterization:

    • Standardized growth conditions for comparability

    • Consistent membrane preparation protocols

    • Normalized enzyme activity measurements

    • Well-defined reference strains as controls

  • Genetic manipulation:

    • Allelic exchange to compare nqrE variants in isogenic backgrounds

    • CRISPR-Cas9 for precise genetic modifications

    • Controlled expression systems to normalize protein levels

  • Data integration:

    • Correlation of sequence variations with functional differences

    • Integration with clinical metadata

    • Statistical approaches to identify significant associations

    • Consideration of population structure in analyses

By applying these methodological considerations, researchers can generate robust and reproducible data on nqrE diversity and its functional implications across clinical isolates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.