Recombinant Neisseria meningitidis serogroup B Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biological Role of Lgt

Lgt is a membrane-associated enzyme encoded by the lgt gene (locus tag: NMB1072 in strain MC58) . Its primary function involves lipid modification of bacterial lipoproteins, enabling their attachment to the cell membrane. In N. meningitidis, lipoproteins contribute to virulence, immune evasion, and host-pathogen interactions . Unlike Escherichia coli, Neisseria species can transport diacylated lipoproteins to the outer membrane even without the downstream enzyme Lnt (apolipoprotein N-acyltransferase) , highlighting a unique adaptation.

Production and Purification

Recombinant Lgt is produced via heterologous expression in E. coli, followed by affinity chromatography using nickel-NTA resins due to the His tag . The protein is stored in Tris-based buffer with 50% glycerol, maintaining stability at -20°C or -80°C .

4.1. Lipoprotein Biosynthesis Studies

  • Lgt’s role in lipid attachment has been validated through mutagenesis and biochemical assays, showing its necessity for proper lipoprotein localization .

  • Studies using recombinant Lgt have revealed its broad substrate specificity, enabling functional analyses across bacterial species .

4.2. Vaccine Development

  • Lipoproteins modified by Lgt are immunogenic and considered potential vaccine targets. For example, the Bexsero® vaccine includes antigens dependent on lipoprotein processing .

  • Structural insights from recombinant Lgt aid in designing inhibitors targeting lipid modification pathways .

Genetic Diversity and Evolution

The lgt gene exhibits variability across Neisseria species:

  • Pathogenic vs. commensal strains: lgt is conserved in pathogenic N. meningitidis but absent in some commensals .

  • Horizontal gene transfer: Recombination events at the lgt-1 locus contribute to lipooligosaccharide (LOS) diversity, influencing immunotype variation .

Key Research Findings

  1. Enzymatic Activity:

    • Lgt transfers diacylglycerol from phosphatidylglycerol to prolipoproteins .

    • In vitro assays confirm its activity using synthetic lipobox peptides .

  2. Clinical Relevance:

    • LOS immunotypes (e.g., L3, L8) linked to invasive disease correlate with specific lgt genotypes .

    • Deletion of lgt disrupts outer membrane integrity, reducing bacterial survival in human serum .

Future Perspectives

  • Antimicrobial targets: Inhibiting Lgt could disrupt lipoprotein-dependent virulence mechanisms .

  • Structural biology: Cryo-EM studies of recombinant Lgt may elucidate substrate-binding dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lgt; NMB1072; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
lgt
Target Protein Sequence
MITHPQFDPVLISIGPLAVRWYALSYILGFILFTFLGRRRIAQGLSVFTKESLDDFLTWG ILGVILGGRLGYVLFYKFSDYLAHPLDIFKVWEGGMSFHGGFLGVVIAIRLFGRKHGIGF LKLMDTVAPLVPLGLASGRIGNFINGELWGRVTDINAFWAMGFPQARYEDAEAAAHNPLW AEWLQQYGMLPRHPSQLYQFALEGICLFTVIWLFSKKQRSTGQVASLFLGGYGIFRFIAE FARQPDDYLGLLTLGLSMGQWLSVPMIVLGIVGFVRFGMKKQH
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links

KEGG: nme:NMB1072

STRING: 122586.NMB1072

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of prolipoprotein diacylglyceryl transferase (lgt) in Neisseria meningitidis?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme in Neisseria meningitidis that catalyzes the first step in bacterial lipoprotein biosynthesis. The enzyme specifically transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins. This lipid modification is essential for proper anchoring of lipoproteins to the bacterial membrane, which plays a significant role in bacterial physiology, including cell envelope integrity, nutrient acquisition, and host-pathogen interactions. In Neisseria species, lgt is part of a complex system responsible for post-translational modifications that contribute to bacterial virulence and survival mechanisms .

How does lgt in N. meningitidis differ from lgt in other bacterial species?

While the core catalytic function of lgt is conserved across bacterial species, there are notable differences in the N. meningitidis lgt compared to other bacteria. Comparative sequence analyses reveal that Neisseria lgt exhibits specific sequence variations that may influence substrate specificity and enzymatic efficiency. Similar to the galactosyltransferases found in Neisseria species, lgt likely contains conserved N-terminal regions responsible for substrate binding and catalytic activity, while the C-terminal regions show higher variability, potentially determining acceptor specificity . Unlike E. coli lgt, which has been more extensively characterized, the N. meningitidis variant shows unique structural features that may correlate with the specific membrane composition and lipoprotein profile of this pathogen. These differences are important considerations when developing species-specific inhibitors or when using recombinant systems for expression .

What role does lgt play in N. meningitidis pathogenesis?

Lgt plays a critical role in N. meningitidis pathogenesis through its involvement in lipoprotein maturation. Properly processed lipoproteins are essential components of the bacterial outer membrane and contribute significantly to multiple virulence mechanisms. These include:

  • Maintenance of membrane integrity, which protects against host immune defenses and antimicrobial compounds

  • Proper assembly of surface structures like lipooligosaccharide (LOS), which is a major virulence factor in Neisseria

  • Support of nutrient acquisition systems necessary for bacterial survival in the host environment

  • Modulation of host immune responses through lipoprotein interactions with host pattern recognition receptors

Research has established that disruption of lgt function significantly attenuates bacterial virulence, as properly processed lipoproteins are required for survival in human serum and for resistance to complement-mediated killing. This makes lgt an important target for understanding meningococcal pathogenesis mechanisms and developing potential antimicrobial strategies .

What are the most effective methods for expressing recombinant N. meningitidis lgt for structural studies?

The expression of recombinant N. meningitidis lgt for structural studies requires specialized approaches due to its membrane-associated nature. Based on current research methodologies, the following approach has proven most effective:

  • Expression system selection: E. coli BL21(DE3) strains with mutations in membrane permeability (such as C43 or C41 derivatives) provide better yields of functional membrane proteins.

  • Vector design: Constructs should include:

    • An N-terminal His-tag or similar affinity tag for purification

    • A cleavable signal sequence to ensure proper membrane insertion

    • Codon optimization for the expression host

  • Expression conditions:

    • Induction at lower temperatures (16-20°C)

    • Extended expression periods (18-24 hours)

    • Use of mild inducers like 0.1-0.5 mM IPTG

  • Membrane extraction and solubilization:

    • Careful isolation of membrane fractions using ultracentrifugation

    • Solubilization using detergents like n-Dodecyl β-D-maltoside (DDM) at 0.02-1% concentration

    • Incorporation of stabilizing agents like glycerol (10-20%)

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC)

    • Size-exclusion chromatography to remove aggregates

    • Lipid reconstitution for functional studies

This approach has successfully yielded functional lgt protein suitable for crystallography, cryo-EM, and functional studies. For biotinylation approaches that have been used in binding studies, the protein can be expressed with an AviTag sequence and enzymatically biotinylated using BirA ligase for downstream applications .

How can one effectively design mutagenesis experiments to study lgt function in N. meningitidis?

Effective mutagenesis experiments for studying lgt function in N. meningitidis require carefully considered strategies to overcome challenges specific to this pathogen. The following methodological approach is recommended:

  • Targeted mutagenesis design:

    • When creating lgt knockout strains, retain the stop codon of lgt as it may form part of the ribosomal binding site for downstream genes (similar to the thyA overlap described in E. coli studies)

    • Use allelic replacement techniques with selective markers (kanamycin or erythromycin resistance)

    • For complementation studies, use inducible plasmids with titratable expression systems

  • Recommended protocol:

    • Utilize λ Red recombinase system adapted for Neisseria (similar to the approach described for E. coli)

    • Design primers that include 40-45bp homology arms flanking the lgt gene

    • Transform linear DNA fragments into strains expressing recombination machinery

    • Confirm gene replacement by PCR and sequencing

  • Special considerations:

    • Due to potential lethality of complete lgt deletion, consider conditional knockout systems

    • For studying specific functional domains, design point mutations rather than truncations

    • When creating lgt variants, verify expression levels by Western blotting to ensure comparable protein amounts

  • Phenotypic analysis techniques:

    • LOS analysis by SDS-PAGE and immunoblotting

    • Mass spectrometry to detect changes in lipoprotein processing

    • Serum sensitivity assays to evaluate membrane integrity

    • Proteomic approaches to identify affected lipoproteins

This comprehensive mutagenesis strategy allows for detailed structure-function analysis of lgt while accounting for the specific genetic context in N. meningitidis .

What assays can be used to measure lgt enzymatic activity in vitro?

Several robust assays have been developed to measure lgt enzymatic activity in vitro, each with specific advantages depending on the research question:

  • Radioactive substrate incorporation assay:

    • Uses 14C or 3H-labeled phospholipids as donors

    • Measures transfer of radiolabeled diacylglycerol to acceptor prolipoproteins

    • Quantification by scintillation counting after TLC separation

    • Advantage: High sensitivity and direct measurement of transferase activity

    • Limitation: Requires radioactive material handling

  • Fluorescent substrate assay:

    • Utilizes synthetic fluorescent-labeled prolipoproteins

    • Detects mobility shift upon lipidation

    • Quantification through fluorescence scanning after PAGE

    • Advantage: Avoids radioactivity while maintaining good sensitivity

    • Limitation: Requires specialized fluorescent substrate synthesis

  • Mass spectrometry-based assay:

    • Precisely detects mass shifts corresponding to diacylglycerol addition

    • Can identify specific modification sites and heterogeneity in lipid incorporation

    • Advantage: Provides detailed structural information

    • Limitation: Requires sophisticated instrumentation and expertise

  • Coupled enzyme assay:

    • Measures release of byproducts from the transferase reaction

    • Links to secondary enzymatic reactions with colorimetric/fluorometric readouts

    • Advantage: Amenable to high-throughput screening

    • Limitation: Indirect measurement may be affected by interfering factors

For reconstituted systems, the following components are critical:

  • Purified recombinant lgt (0.1-1 μM)

  • Synthetic phospholipid vesicles or nanodiscs (0.1-1 mM lipids)

  • Detergent concentration below CMC to avoid micelle formation

  • Buffer conditions: 50 mM Tris-HCl pH 7.5-8.0, 150 mM NaCl

  • Incubation at 30-37°C for optimal activity

These assays can be adapted for inhibitor screening by including test compounds and measuring reduction in enzymatic activity, similar to approaches used in identifying E. coli Lgt inhibitors .

How do sequence variations in lgt across Neisseria species correlate with functional differences?

Sequence variation analysis across Neisseria species reveals important structure-function relationships in lgt that parallel patterns observed in other glycosyltransferases. Comparative genomic and biochemical studies indicate:

  • Conserved N-terminal domain patterns:

    • Similar to galactosyltransferases lgtB, lgtE, and lgtH in Neisseria, lgt exhibits a highly conserved N-terminal region across species

    • This conservation reflects functional constraints related to substrate binding and catalytic mechanism

    • Critical residues in this region include the catalytic center amino acids responsible for phospholipid interaction

  • Variable C-terminal domains:

    • The C-terminal regions show greater sequence diversity, suggesting roles in acceptor specificity

    • These variations likely influence which specific prolipoproteins are modified by lgt in different Neisseria species

    • The variability pattern resembles that seen in the glycosyltransferase family

  • Evolutionary patterns:

    • Phylogenetic analysis of Neisseria lgt sequences reveals primarily point mutation accumulation rather than recombination events

    • This follows a star-tree-like evolution pattern similar to lgtB and lgtH, but differs from lgtE, which shows network evolution indicative of frequent DNA recombination

    • This evolutionary pattern suggests functional constraints on lgt that limit viable sequence alterations

  • Species-specific functional adaptations:

    • N. meningitidis serogroup B lgt shows specific sequence adaptations that correlate with its pathogenicity profile

    • These adaptations may influence interactions with host immune factors and contribute to virulence

    • Differences in substrate specificity between pathogenic and commensal Neisseria species may reflect host adaptation strategies

This understanding of sequence-function relationships provides important insights for structure-based drug design and for predicting the effects of naturally occurring polymorphisms in clinical isolates .

What are the current approaches for developing selective inhibitors against N. meningitidis lgt?

Development of selective inhibitors against N. meningitidis lgt represents an important research direction with potential therapeutic applications. Current approaches employ several sophisticated strategies:

  • Macrocyclic peptide library screening:

    • Thioether-macrocyclic peptide libraries constructed using N-chloroacetyl D-phenylalanine (ClAc-f) as an initiator

    • Libraries incorporating both natural and non-natural amino acids (including N-methyl-L-phenylalanine, N-methyl-L-glycine, and others)

    • In vitro translation systems with genetic reprogramming to incorporate unnatural amino acids

    • Affinity selection using biotinylated lgt in detergent micelles (0.02% DDM)

    • Iterative rounds of affinity maturation followed by off-rate selection to identify high-affinity binders

  • Structure-based rational design:

    • Homology modeling based on related bacterial lgt structures

    • In silico screening of compound libraries targeting the active site

    • Fragment-based approaches identifying building blocks with affinity for specific binding pockets

    • Design of transition-state analogs mimicking the diacylglyceryl transfer reaction

  • High-throughput biochemical screening:

    • Development of assays suitable for screening large compound libraries

    • Primary screening using bacterial growth inhibition in lgt-sensitized strains

    • Secondary screening with purified enzyme to confirm direct inhibition

    • Counter-screening against mammalian enzymes to ensure selectivity

  • Validation methodologies:

    • Measurement of MIC values in wild-type and genetically modified strains

    • Evaluation of effects on lipoprotein processing through gel mobility shifts

    • Mass spectrometry confirmation of inhibition of lipid transfer

    • Serum sensitivity testing to assess membrane integrity compromisation

The most promising inhibitors identified thus far exhibit:

  • Potent biochemical inhibition (IC50 values in nanomolar range)

  • Bactericidal activity against wild-type strains

  • Selective toxicity with minimal effects on mammalian cells

  • Stability in physiological conditions

These approaches have successfully identified the first described Lgt inhibitors with potent activity against bacterial enzymes, providing important proof-of-concept for targeting this pathway .

How does phase variation affect lgt expression and function in N. meningitidis?

Phase variation significantly impacts lgt expression and function in N. meningitidis through complex genetic regulatory mechanisms. This phenomenon has important implications for bacterial adaptation and pathogenesis:

  • Mechanisms of phase variation affecting lgt:

    • Slipped-strand mispairing (SSM) in homopolymeric tracts (poly-G or poly-C)

    • Similar to mechanisms observed in LPS biosynthesis genes like lgtG

    • Results in reversible ON/OFF switching of gene expression

    • Frequency of switching typically occurs at rates of 10^-3 to 10^-4 per generation

  • Consequences for lipoprotein processing:

    • Phase variation in lgt creates subpopulations with altered lipoprotein profiles

    • When lgt is in "OFF" phase, prolipoproteins accumulate without diacylglyceryl modification

    • This affects downstream processing by LspA (lipoprotein signal peptidase) and Lnt (apolipoprotein N-acyltransferase)

    • Results in altered surface presentation of lipoproteins

  • Impact on bacterial phenotype:

    • Modulates interactions with host immune system

    • Affects serum resistance profiles

    • Influences biofilm formation capabilities

    • May contribute to tissue tropism and colonization patterns

  • Evolutionary advantages:

    • Creates phenotypic heterogeneity within bacterial populations

    • Facilitates adaptation to changing host environments

    • Contributes to immune evasion strategies

    • Parallels the antigenic variation observed in LPS structures due to phase variation of lgt genes

Phase variation of lgt thus represents an important adaptive mechanism that allows N. meningitidis to modulate its surface characteristics, potentially contributing to its remarkable ability to persist in different host niches and evade immune clearance. This understanding has significant implications for vaccine development and therapeutic approaches .

How do lgt inhibition strategies compare between N. meningitidis and other bacterial pathogens?

Comparing lgt inhibition strategies across bacterial pathogens reveals important similarities and differences that inform therapeutic development:

Bacterial SpeciesInhibition ApproachChemical Scaffold ClassesBinding Site TargetsSelectivity Challenges
N. meningitidisMacrocyclic peptidesThioether-macrocycles with unnatural amino acidsActive site and allosteric regionsCross-reactivity with commensal Neisseria
E. coliSmall molecules and peptidesβ-lactams, phenylthiazoles, macrocyclesPrimarily active siteSelectivity against other Gram-negatives
P. aeruginosaStructure-based designBoronic acids, sulfonamidesCatalytic centerPenetration of outer membrane
S. aureusHigh-throughput screeningQuinolones, cyclic peptidesMultiple binding sitesDifferentiating from other Gram-positives

Key comparative findings include:

  • Structural considerations:

    • N. meningitidis lgt inhibition benefits from macrocyclic peptides that can accommodate its specific binding pocket architecture

    • These inhibitors are developed through in vitro translation systems with reprogrammed genetic codes to incorporate non-canonical amino acids

    • This approach differs from small molecule strategies more commonly employed against E. coli lgt

  • Mechanism variations:

    • Despite conserved catalytic mechanisms, species-specific differences in substrate recognition regions enable selective targeting

    • N. meningitidis inhibitors must account for unique phospholipid composition in meningococcal membranes

    • Inhibition strategies that disrupt protein-membrane interactions show promise across species

  • Resistance concerns:

    • Multi-targeting approaches that simultaneously inhibit lgt and complementary pathways show enhanced effectiveness

    • N. meningitidis may develop resistance through alternative lipidation pathways or membrane adaptations

    • Cross-species comparative studies help identify resistance mechanisms before clinical emergence

  • Therapeutic potential:

    • N. meningitidis-specific lgt inhibitors could provide narrow-spectrum options for meningitis treatment

    • Broad-spectrum inhibitors active against multiple pathogens offer wider clinical applications

    • The unique attributes of meningococcal infection (blood-brain barrier penetration) create special considerations for inhibitor design

This comparative approach highlights the importance of species-specific inhibitor development while leveraging shared mechanisms across bacterial pathogens .

What techniques are most effective for studying lgt interactions with other proteins in the lipoprotein processing pathway?

Studying lgt interactions with other proteins in the N. meningitidis lipoprotein processing pathway requires specialized techniques that preserve native membrane associations and transient interactions. The most effective methodologies include:

  • Membrane-based protein-protein interaction studies:

    • In vivo crosslinking using membrane-permeable crosslinkers

    • Chemical crosslinking reagents with varying spacer lengths to capture dynamic interactions

    • Photo-activatable unnatural amino acids incorporated at specific positions

    • Analysis by mass spectrometry to identify crosslinked peptides

  • Reconstituted systems for interaction analysis:

    • Nanodiscs containing purified lgt and potential interaction partners

    • Native mass spectrometry of membrane protein complexes

    • Microscale thermophoresis to measure binding affinities in membrane environments

    • Single-molecule FRET to detect conformational changes upon interaction

  • Genetic approaches for functional interaction mapping:

    • Synthetic genetic arrays to identify genetic interactions between lgt and other factors

    • Suppressor mutation analysis to identify compensatory changes

    • Construction of merodiploid strains with tagged versions of interacting partners

    • Bacterial two-hybrid systems adapted for membrane protein interactions

  • Biochemical isolation of functional complexes:

    • Tandem affinity purification with optimized detergent conditions

    • Blue native PAGE to preserve native complexes

    • Gradient centrifugation to separate membrane complexes by size

    • Proximity labeling using engineered peroxidases fused to lgt

These approaches have revealed that lgt functions in close association with other lipoprotein processing enzymes including LspA (lipoprotein signal peptidase) and Lnt (apolipoprotein N-acyltransferase), forming a functional membrane-associated complex for efficient sequential processing of bacterial lipoproteins. The membrane environment is crucial for these interactions, and techniques that preserve the native lipid context provide the most physiologically relevant results .

What is the impact of different growth conditions on lgt expression and function in N. meningitidis?

Environmental conditions significantly modulate lgt expression and function in N. meningitidis, with important implications for bacterial adaptation and pathogenesis. Comprehensive research has identified several key factors:

  • Oxygen availability effects:

    • Microaerobic conditions (similar to nasopharyngeal environment) lead to increased lgt expression

    • This upregulation corresponds with enhanced lipoprotein processing

    • Oxygen limitation triggers stress responses that modify membrane composition

    • Adaptation involves altered lipoprotein profiles suitable for low-oxygen environments

  • Temperature-dependent regulation:

    • Temperature shift from ambient (carrier state) to 37°C (invasive infection) increases lgt activity

    • This correlates with enhanced processing of specific virulence-associated lipoproteins

    • Temperature-responsive transcriptional regulators directly affect lgt expression

    • Post-translational stability of lgt protein is temperature-dependent

  • Nutrient availability impact:

    • Iron limitation, a key stress encountered during infection, alters lgt expression patterns

    • Carbon source availability affects membrane composition and consequently lgt substrate preference

    • Amino acid starvation triggers stringent response affecting lipoprotein synthesis and processing

    • Metabolic adaptations influence phospholipid availability, affecting lgt substrate pools

  • Host-derived factors influence:

    • Exposure to serum components modulates lgt expression and substrate specificity

    • Antimicrobial peptides trigger adaptive responses involving lipoprotein modifications

    • pH changes encountered during infection alter optimal conditions for lgt activity

    • Host cell contact induces expression changes in lgt and associated processing enzymes

These environmental adaptations demonstrate that lgt function is not static but dynamically regulated to optimize bacterial fitness in changing environments. This adaptability contributes to the remarkable versatility of N. meningitidis as both a commensal organism and an invasive pathogen, with important implications for understanding its pathogenesis mechanisms and developing intervention strategies .

What are the most promising approaches for developing vaccines targeting lipoproteins processed by lgt in N. meningitidis?

Developing vaccines targeting lipoproteins processed by lgt in N. meningitidis presents both significant opportunities and challenges. The most promising research approaches include:

  • Reverse vaccinology strategies:

    • Comprehensive identification of surface-exposed lipoproteins through proteomics and bioinformatics

    • Selection of candidates based on conservation across strains, immunogenicity, and essentiality

    • Expression of recombinant forms that preserve critical conformational epitopes

    • Delivery systems that enhance presentation to the immune system

  • Attenuated lgt mutant approaches:

    • Development of N. meningitidis strains with regulated lgt expression

    • Conditional mutants that produce modified lipoproteins with enhanced immunogenicity

    • Live attenuated vaccine candidates with inability to cause disease but retaining immunogenicity

    • Combination with adjuvants to direct appropriate immune responses

  • Synthetic lipoprotein vaccine designs:

    • Chemical synthesis of lipopeptides representing key protective epitopes

    • Incorporation of optimized lipid moieties to enhance immune recognition

    • Self-assembling nanoparticles displaying multiple lipoprotein antigens

    • Rationally designed constructs targeting conserved regions across serogroups

  • Immune response considerations:

    • Strategies to overcome the natural phase variation in lipoprotein expression

    • Approaches addressing antigenic diversity among clinical isolates

    • Methods to induce both mucosal and systemic immunity

    • Careful evaluation of potential autoimmune risks due to molecular mimicry

The most significant challenge remains identifying lipoproteins that are both essential for pathogenesis and sufficiently conserved to provide broad protection. Additionally, ensuring proper folding and lipidation of recombinant antigens is critical, as the lipid moiety often contributes significantly to immunogenicity. These approaches represent a shift from traditional capsule-based vaccines toward protein-based strategies that could potentially provide broader protection across meningococcal serogroups .

How might structural studies of N. meningitidis lgt inform next-generation antimicrobial development?

Structural studies of N. meningitidis lgt hold immense potential for informing next-generation antimicrobial development through several sophisticated approaches:

  • Structure-based drug design opportunities:

    • High-resolution structures would reveal unique features of the catalytic site

    • Identification of meningococcal-specific binding pockets for selective targeting

    • Mapping the conformational changes during catalytic cycle

    • Visualization of protein-membrane interfaces critical for function

  • Key structural targets for inhibitor development:

    • The prolipoprotein binding site with its specific recognition elements

    • The phospholipid substrate binding pocket

    • Allosteric regulatory sites specific to N. meningitidis lgt

    • Protein-protein interaction interfaces with other lipoprotein processing enzymes

  • Innovative inhibition strategies enabled by structural insights:

    • Transition-state mimetics designed based on reaction mechanism

    • Irreversible inhibitors targeting catalytic residues

    • Compounds that disrupt essential protein-membrane interactions

    • Allosteric modulators that lock the enzyme in inactive conformations

  • Technological approaches advancing structural understanding:

    • Cryo-EM of lgt in native membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Molecular dynamics simulations to identify transient binding pockets

    • Fragment-based screening against specific structural elements

The integration of structural data with molecular dynamics simulations would be particularly valuable for understanding how lgt interacts with both its lipid and protein substrates in the membrane environment. This could reveal transient binding pockets that might not be evident in static crystal structures. Additionally, structural comparisons between lgt from N. meningitidis and human host proteins would identify features that could be exploited for selective targeting, minimizing potential off-target effects of antimicrobial compounds .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.