Recombinant Neisseria meningitidis serogroup B Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; NMB1065; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
crcB
Target Protein Sequence
MLSNIIPLSIGAALGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWK LLLITGFLGSLTTLSGFSLETVTLLQLNRPASALANIFLHTAGSLLLTWLGLKIGAAVK
Uniprot No.

Target Background

Function
Important for reducing fluoride concentration in the cell, thereby decreasing its toxicity.
Database Links

KEGG: nme:NMB1065

STRING: 122586.NMB1065

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog protein and what is its significance in Neisseria meningitidis serogroup B?

The CrcB homolog in N. meningitidis serogroup B is a membrane protein primarily involved in fluoride ion transport and resistance mechanisms. In bacterial systems, CrcB proteins form channels that export fluoride ions from the cytoplasm, protecting cellular processes from fluoride toxicity. While not explicitly mentioned in the current literature on N. meningitidis genomics, this protein likely contributes to bacterial survival in diverse environments, potentially including host niches during infection.

Methodology for investigation would include comparative genomic analysis across N. meningitidis strains, similar to the whole genome sequencing (WGS) approaches described for other N. meningitidis proteins, where researchers identified significant genetic diversity including novel sequence types (STs) and gene variants .

How is CrcB structurally and functionally characterized in meningococci?

Structural and functional characterization of CrcB would employ multiple complementary approaches. Structurally, techniques include bioinformatic prediction of transmembrane domains, protein crystallography, and comparative modeling based on homologous proteins. Functionally, characterization would involve fluoride transport assays using reconstituted protein in liposomes and phenotypic analysis of crcB knockout mutants.

Similar methodological approaches to those used for analyzing other N. meningitidis proteins can be applied, including multiple sequence alignment using tools like Jalview with MAFFT settings, as employed for analyzing penA gene variations . Functional predictions could utilize tools like PathogenFinder and VFDB for pathogenicity and virulence factor identification, respectively .

What genomic diversity exists in crcB genes across different Neisseria meningitidis strains?

Genomic diversity in crcB genes would be assessed through comparative genomics of multiple N. meningitidis isolates. Based on research examining other genes in this organism, significant diversity may exist. Recent genomic studies of N. meningitidis have revealed substantial genetic variation, with 21 different sequence types identified from a single country's isolates .

The methodology would include WGS of multiple strains, followed by core genome multilocus sequence typing (cgMLST) and minimum spanning tree (MST) analysis to determine relationships between different variants, similar to approaches that have been used to analyze other N. meningitidis genes .

What expression systems are optimal for producing recombinant CrcB protein?

Optimal expression of recombinant CrcB protein would require specialized systems for membrane proteins. Potential expression systems include:

  • E. coli strains specialized for membrane protein expression (C41/C43)

  • Cell-free expression systems with supplied lipids

  • Eukaryotic expression systems for complex membrane proteins

Key methodological considerations include:

  • Selection of appropriate vectors with inducible promoters

  • Strategic placement of affinity tags (C-terminal preferred for membrane proteins)

  • Inclusion/exclusion of signal peptides

  • Expression temperature optimization

  • Detergent selection for solubilization

Research on N. meningitidis MIP protein demonstrates that tag placement and signal peptide inclusion significantly impact protein functionality, with C-terminal His-tagged constructs showing superior performance compared to N-terminal tagged variants .

How can truncation strategies be employed to enhance immunogenicity of CrcB protein?

Truncation strategies for CrcB should focus on removing regions with potential cross-reactivity to human proteins while preserving immunogenic epitopes. The methodology would include:

  • Bioinformatic analysis to identify conserved domains

  • Creation of multiple constructs with systematic truncations

  • Evaluation of each construct for:

    • Expression efficiency

    • Antibody generation capacity

    • Bactericidal activity

    • Absence of cross-reactivity with human proteins

This approach parallels successful strategies employed for N. meningitidis MIP protein, where researchers created truncated versions lacking the globular domain (which showed sequence similarity to human FK506-binding proteins) while retaining the immunogenic portions. The C-terminally His-tagged truncated rMIP protein without leader peptide delivered in liposomes induced high-titer bactericidal antibodies that recognized diverse meningococcal strains .

What single-case experimental designs are appropriate for studying CrcB function in host-pathogen interactions?

Single-case experimental designs (SCEDs) provide powerful approaches for studying CrcB function in specific host contexts. Appropriate designs include:

  • Reversal designs - alternating between wild-type and crcB mutant conditions

  • Multiple baseline designs - measuring multiple outcomes across different conditions

  • Combined reversal and multiple baseline designs - providing robust causal evidence

These experimental approaches allow for precise determination of CrcB's contribution to pathogenesis in individual host settings. SCEDs focus on demonstrating experimental control through within-subject comparisons, with randomization of intervention order to reduce threats to internal validity .

How should researchers interpret genomic data to identify novel crcB variants?

Interpreting genomic data to identify novel crcB variants requires systematic analysis following these methodological steps:

  • Whole genome sequencing of diverse N. meningitidis isolates

  • Identification of crcB gene sequences through reference mapping or de novo assembly

  • Multiple sequence alignment of identified variants

  • Phylogenetic analysis to determine evolutionary relationships

  • Functional prediction based on sequence variations

This approach mirrors methods used to identify novel variants of other N. meningitidis genes, where researchers discovered new allelic variants including previously uncharacterized penA profiles with potential functional implications . Visualization tools like interactive Tree of Life (iTOL) can be employed for constructing and analyzing phylogenetic relationships .

What statistical approaches are appropriate for analyzing CrcB protein function across multiple strains?

Statistical analysis of CrcB function across multiple strains should employ:

  • Mixed-effects models to account for strain-specific variations

  • ANOVA for comparing multiple experimental conditions

  • Post-hoc tests with appropriate corrections for multiple comparisons

  • Correlation analyses between genetic variants and phenotypic outcomes

For complex datasets involving multiple variables, multivariate approaches such as principal component analysis can help identify patterns of co-variation. When analyzing strain relationships based on CrcB sequence variations, hierarchical clustering methods like UPGMA (Unweighted Pair Group Method with Arithmetic Mean) provide valuable insights, similar to the approach used for analyzing genetic relationships among N. meningitidis isolates .

How can researchers resolve contradictory findings regarding CrcB function?

Resolving contradictory findings about CrcB function requires methodical investigation following these steps:

  • Systematic evaluation of experimental conditions across studies

  • Replication of experiments with standardized protocols

  • Meta-analysis of available data using random-effects models

  • Investigation of strain-specific genetic backgrounds that might influence results

  • Examination of potential compensatory mechanisms

This approach prioritizes methodological consistency while acknowledging biological variability. When contradictions arise, researchers should consider the complete genomic context, including the presence of other genes that might compensate for CrcB function or modify its activity in specific genetic backgrounds .

How does CrcB contribute to antibiotic resistance mechanisms in N. meningitidis?

Investigation of CrcB's contribution to antibiotic resistance would follow these methodological steps:

  • Creation of crcB deletion mutants and complemented strains

  • Determination of minimum inhibitory concentrations for various antibiotics

  • Transcriptional analysis of resistance-associated genes in wild-type vs. mutant strains

  • Evaluation of membrane permeability and efflux activity

This approach builds on established methods for studying antimicrobial resistance in N. meningitidis, where researchers have identified diverse resistance mechanisms including modified target sites and efflux systems. Analysis would incorporate tools like Resistance Gene Identifier from CARD to detect known resistance determinants, combined with phenotypic susceptibility testing .

What role does CrcB play in N. meningitidis metabolic adaptation during infection?

Investigating CrcB's role in metabolic adaptation requires:

  • Transcriptomic analysis comparing crcB expression under different environmental conditions

  • Metabolomic profiling of wild-type vs. crcB mutants

  • Isotope labeling studies to track metabolic flux changes

  • In vivo expression studies during different infection stages

This methodological approach parallels techniques used to characterize metabolic pathways in N. meningitidis, where researchers identified strain-specific variations in pathways like dTDP-L-rhamnose biosynthesis, which impacts cell surface structure and bacterial interactions with the environment . KEGG pathway analysis would be employed to categorize detected metabolic differences into functional subcategories .

How can structural knowledge of CrcB be leveraged for vaccine development?

Leveraging CrcB structure for vaccine development would follow this methodological framework:

  • Identification of surface-exposed regions through structural prediction

  • Assessment of epitope conservation across diverse strains

  • Evaluation of cross-reactivity with human proteins

  • Production of recombinant constructs focusing on immunogenic regions

  • Immunization studies measuring bactericidal antibody production

Construct DesignAdvantagesChallenges
Full-length CrcBComplete epitope preservationPotential cross-reactivity, expression difficulties
Truncated extracellular domainsEasier expression, focused immune responsePotential loss of conformational epitopes
Multi-epitope constructsTargeting multiple conserved regionsRequires precise epitope mapping

This approach builds on successful strategies used for other N. meningitidis vaccine antigens, where researchers found that truncated constructs lacking regions with similarity to human proteins, delivered in liposomes, induced high levels of bactericidal antibodies against diverse strains .

What are the optimal methods for genetic manipulation of crcB in N. meningitidis?

Genetic manipulation of crcB in N. meningitidis would employ:

  • Allelic exchange techniques using suicide vectors

  • Natural transformation exploiting N. meningitidis competence

  • CRISPR-Cas9 systems adapted for meningococcal genetics

  • Inducible expression systems for controlled gene regulation

Verification of genetic modifications should combine PCR confirmation, whole genome sequencing, and phenotypic assays. For analyzing gene function, MLRT (multilocus restriction typing) provides a valuable approach for characterizing genetic relationships between wild-type and modified strains, similar to methods employed for characterizing N. meningitidis diversity .

What high-throughput approaches can identify small molecule modulators of CrcB function?

High-throughput screening for CrcB modulators would follow this methodological cascade:

  • Primary fluorescent ion flux assays using purified CrcB in liposomes

  • Secondary cellular assays measuring fluoride sensitivity in CrcB-dependent conditions

  • Target engagement confirmation through thermal shift assays

  • Structure-activity relationship studies of promising compounds

Data analysis would employ machine learning algorithms to identify structural features associated with activity. Visualization tools similar to those used for CRC dashboard development could help researchers track screening campaigns and make data-driven decisions about compound progression .

How can advanced imaging techniques contribute to understanding CrcB localization and dynamics?

Advanced imaging of CrcB would employ:

  • Super-resolution microscopy to determine precise membrane localization

  • Fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

  • Single-molecule tracking to analyze diffusion dynamics

  • Correlative light and electron microscopy for structural context

The methodology would require generation of fluorescent protein fusions or antibody-based detection systems optimized to maintain native protein function. Time-lapse imaging during bacterial interaction with host cells could reveal dynamic changes in CrcB distribution during infection processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.