Recombinant Neisseria meningitidis serogroup B Putative zinc metalloprotease NMB0183 (NMB0183)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Neisseria meningitidis Serogroup B Putative Zinc Metalloprotease NMB0183

Recombinant Neisseria meningitidis serogroup B Putative Zinc Metalloprotease NMB0183, or NMB0183, is a protein expressed by the bacterium Neisseria meningitidis serogroup B . N. meningitidis is a bacterium that can cause serious infections, including meningitis and septicemia . NMB0183 is annotated as a putative zinc metalloprotease, suggesting it may utilize a zinc ion to perform its enzymatic function as a protease . Metalloproteases are enzymes that catalyze the hydrolysis of peptide bonds in proteins, using a metal ion, such as zinc, in their active site .

Characteristics of NMB0183

CharacteristicDescription
Product Short NamePutative zinc metalloprotease NMB0183
SynonymsHypothetical protein NMB0183, Putative zinc metalloprotease NMB0183
Gene NameNMB0183
HostE. coli
FormLiquid containing glycerol
Storage and StabilityStore at -20°C; for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .

Function and Significance

The precise function of NMB0183 in N. meningitidis is not yet fully understood, but it is likely involved in bacterial physiology or pathogenesis due to its classification as a putative zinc metalloprotease . Some potential functions and significance include:

  1. Nutritional Immunity and Metal Acquisition: N. meningitidis expresses proteins like CbpA (also referred to as TdfH), which can bind to proteins like calprotectin to acquire zinc, an essential nutrient, from the host environment . NMB0183 may play a role in processing proteins involved in metal acquisition or in the bacteria's response to nutritional immunity .

  2. Virulence and Pathogenesis: Metalloproteases are known virulence factors in various bacteria . They can degrade host tissues, inactivate immune components, or interfere with host cell signaling pathways . NMB0183 could contribute to the ability of N. meningitidis to colonize, invade, and cause disease .

  3. Vaccine Antigen Discovery: Proteins expressed by N. meningitidis during bloodstream infection are of interest as potential vaccine candidates . Upregulation of certain genes, including those encoding surface-exposed proteins, suggests their importance for bacterial survival and makes them attractive targets for vaccine development .

Zinc Metalloproteases

Zinc metalloproteases, like NMB0183, are characterized by the presence of a zinc ion in their active site, which is essential for their catalytic activity . These enzymes typically have a conserved motif, such as HEXXH, that coordinates the zinc ion . The zinc ion assists in the hydrolysis of peptide bonds by polarizing the carbonyl group of the substrate and stabilizing the transition state .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NMB0183; Putative zinc metalloprotease NMB0183
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
NMB0183
Target Protein Sequence
MHTLLAFIFAILILVSLHEFGHYIVARLCGVKVVRFSVGFGKPFFTRKRGDTEWCLAPIP LGGYVKMVDTREGEVSEADLPYAFDKQHPAKRIAIVAAGPLTNLALAVLLYGLSFSFGVT ELRPYVGTVEPDTIAARAGFQSGDKIQSVNGTPVADWGSAQTEIVLNLEAGKVAVGVQTA SGAQTVRTIDAAGTPEAGKIAKNQGYIGLMPFKITTVAGGVEKGSPAEKAGLKPGDRLTA ADGKPIASWQEWANLTRQSPGKKITLNYERAGQTHTADIRPDTVEQSDHTLIGRVGLRPQ PDRAWDAQIRRSYRPSVVRAFGMGWEKTVSHSWTTLKFFGKLISGNASVSHISGPLTIAD IAGQSAELGLQSYLEFLALVSISLGVLNLLPVPVLDGGHLVFYTAEWIRGKPLGERVQNI GLRFGLALMMLMMAVAFFNDVTRLLG
Uniprot No.

Target Background

Database Links

KEGG: nme:NMB0183

STRING: 122586.NMB0183

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How can researchers effectively express and purify recombinant NMB0183 for functional studies?

Methodological approach:

  • Expression system selection:

    • E. coli is the preferred host for NMB0183 expression, as documented in available recombinant preparations

    • Choose a vector system with inducible promoters (T7 or tac) for controlled expression

    • Incorporate an affinity tag (His-tag is commonly used) for purification

  • Expression optimization:

    • Test multiple induction conditions (IPTG concentration, temperature, duration)

    • Validate expression using SDS-PAGE and Western blot

    • Monitor for inclusion body formation and adjust conditions as needed

  • Purification protocol:

    • Implement a multi-step purification strategy:
      a. Affinity chromatography (Ni-NTA for His-tagged protein)
      b. Ion-exchange chromatography for removing impurities
      c. Size-exclusion chromatography for final polishing

    • Assess purity using SDS-PAGE and mass spectrometry

    • Validate protein folding using circular dichroism

  • Storage optimization:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • Prepare single-use aliquots to avoid freeze-thaw cycles

    • Validate stability with activity assays before experimental use

What experimental approaches are appropriate for investigating NMB0183's role in Neisseria meningitidis pathogenesis?

Methodological approach:

  • Genetic manipulation studies:

    • Generate NMB0183 knockout mutants using transposon mutagenesis or CRISPR-Cas9

    • Create complemented strains to confirm phenotypes

    • Develop point mutations to assess specific functional domains

  • Virulence assessment:

    • Compare wild-type and mutant strains in cellular adhesion and invasion assays

    • Assess biofilm formation capabilities using crystal violet staining

    • Evaluate serum resistance through complement-mediated killing assays

  • Host-pathogen interaction models:

    • Use human nasopharyngeal epithelial cell lines for adhesion studies

    • Implement transwell systems to study bacterial translocation

    • Employ primary human cell cultures to evaluate immune responses

How can researchers design optimal experimental protocols to investigate NMB0183's putative metalloprotease activity?

Methodological approach:

  • Enzymatic activity characterization:

    • Design fluorogenic peptide substrates based on predicted cleavage sites

    • Establish a zinc-dependent activity assay with various metal chelators as controls

    • Determine enzyme kinetics (Km, Vmax, kcat) under varying pH and temperature conditions

    • Perform inhibitor studies with known metalloprotease inhibitors

  • Substrate identification:

    • Conduct proteomic analyses using techniques such as:
      a. TAILS (Terminal Amine Isotopic Labeling of Substrates)
      b. PICS (Proteomic Identification of Cleavage Sites)
      c. Degradomics approaches with N-terminomics

    • Validate identified substrates using in vitro cleavage assays with purified components

    • Generate non-cleavable substrate mutants for functional validation

  • Structure-function analysis:

    • Implement site-directed mutagenesis targeting conserved metalloprotease motifs

    • Perform alanine-scanning mutagenesis of the active site

    • Develop truncated variants to identify minimal catalytic domains

    • Use molecular dynamics simulations to predict substrate binding

  • Experimental design considerations:

    • Include appropriate positive controls (known metalloproteases) in parallel experiments

    • Implement rigorous statistical analysis following principles detailed in "Experimental Design and Data Analysis for Biologists"

    • Consider factorial designs to identify interaction effects between experimental variables

A robust experimental design would follow the principles outlined in Quinn and Keough's approach, utilizing appropriate statistical tests based on the nature of your data and incorporating controls for population structure when analyzing strain variations .

What methodologies are most effective for studying the potential role of NMB0183 in meningococcal vaccine development?

Methodological approach:

  • Antigenicity assessment:

    • Analyze recombinant NMB0183 using:
      a. ELISA with sera from convalescent patients
      b. Western blotting against diverse patient samples
      c. Surface plasmon resonance for antibody affinity measurement

    • Compare immunoreactivity across geographically diverse clinical isolates

    • Assess cross-reactivity with proteins from related Neisseria species

  • Epitope mapping strategies:

    • Implement peptide arrays covering the full NMB0183 sequence

    • Use hydrogen-deuterium exchange mass spectrometry for conformational epitope identification

    • Employ phage display libraries for high-resolution epitope mapping

    • Validate identified epitopes using site-directed mutagenesis

  • Immunogenicity studies:

    • Design recombinant constructs with optimal epitope presentation

    • Evaluate adjuvant formulations for enhanced immune response

    • Measure both humoral and cellular immune responses in animal models

    • Assess memory B-cell responses using ELISpot assays

  • Translation to vaccine development:

    • Consider incorporation into existing MenB vaccine platforms alongside established antigens (FHbp, NadA, NHBA)

    • Evaluate potential for cross-protection against diverse clinical isolates

    • Investigate synergistic effects with other meningococcal antigens

Recent approaches to MenB vaccine development have shifted from polysaccharide-based vaccines to outer membrane proteins due to the poor immunogenicity of the polysaccharide approach . When evaluating NMB0183 as a vaccine candidate, researchers should consider using genetic Meningococcal Antigen Typing System (gMATS) as a correlate for predicting strain coverage .

How can researchers effectively design experiments to elucidate NMB0183's potential role in lipooligosaccharide (LOS) biosynthesis or modification?

Methodological approach:

  • Comparative genomic analysis:

    • Conduct protein homology searches against characterized LOS biosynthesis enzymes

    • Perform synteny analysis to identify genomic context near NMB0183

    • Use structural prediction algorithms to identify potential glycosyltransferase or modification domains

    • Compare sequence conservation across diverse meningococcal lineages

  • Molecular interaction studies:

    • Implement bacterial two-hybrid systems to detect protein-protein interactions

    • Use pull-down assays with tagged NMB0183 to identify interaction partners

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Validate interactions with biolayer interferometry or isothermal titration calorimetry

  • LOS structural analysis:

    • Extract and analyze LOS from wild-type and NMB0183 mutant strains using:
      a. Mass spectrometry (MALDI-TOF, ESI-MS)
      b. NMR spectroscopy
      c. Compositional analysis of monosaccharides

    • Assess changes in LOS phosphoethanolamine content, as phosphorylation of LOS components is important in N. meningitidis virulence

  • Functional assays:

    • Compare serum resistance between wild-type and mutant strains

    • Evaluate complement activation using CH50 and AP50 assays

    • Assess binding to various lectins to determine glycosylation patterns

    • Measure TLR4 activation using reporter cell lines

When designing these experiments, it's important to note that LOS structure is critical for N. meningitidis virulence, as demonstrated in previous studies on inner core biosynthesis . The absence of certain glycosyltransferases can significantly impact bacterial survival and pathogenicity.

What are the optimal approaches for investigating potential interactions between NMB0183 and human host factors?

Methodological approach:

  • Identification of binding partners:

    • Perform protein microarray screening against human serum proteins

    • Use surface plasmon resonance to detect direct binding to candidate host proteins

    • Implement affinity purification-mass spectrometry using tagged NMB0183

    • Screen against human tissue extracts using far-western blotting

  • Functional validation:

    • Develop cell-based assays to assess:
      a. Attachment to human cell lines
      b. Internalization efficiency
      c. Cytotoxic effects
      d. Intracellular trafficking

    • Compare wild-type bacteria with NMB0183 knockouts in these assays

    • Use siRNA knockdown of identified host receptors to confirm specificity

  • Host response characterization:

    • Measure cytokine/chemokine profiles after exposure to purified NMB0183

    • Assess NF-κB activation and inflammasome induction

    • Evaluate neutrophil recruitment and activation

    • Measure impact on complement activation pathways

  • In vitro model systems:

    • Develop 3D cell culture models of blood-brain barrier

    • Use human nasopharyngeal tissue explants

    • Implement organ-on-chip platforms for dynamic interaction studies

    • Employ human immune cell co-culture systems

These approaches should consider that N. meningitidis virulence factors often interact with multiple host proteins. Recent studies have shown that factors like factor H binding protein (FHbp) are important targets in vaccine development , suggesting methodologies used to study such interactions could be adapted for NMB0183 research.

How can researchers effectively integrate multi-omics approaches to understand NMB0183's role in the context of meningococcal pathogenesis?

Methodological approach:

  • Integrated experimental design:

    • Collect paired samples for transcriptomics, proteomics, and metabolomics analysis

    • Compare wild-type, NMB0183 knockout, and complemented strains

    • Include relevant environmental conditions (iron limitation, serum exposure, etc.)

    • Design time-course experiments to capture dynamic responses

  • Multi-omics data generation:

    • Transcriptomics: RNA-seq to identify differentially expressed genes in response to NMB0183 mutation

    • Proteomics: Quantitative proteomics (TMT/iTRAQ) to measure protein-level changes

    • Secretomics: Analysis of secreted/surface proteins in wild-type vs. mutant strains

    • Metabolomics: Targeted and untargeted approaches to identify metabolic perturbations

  • Data integration strategies:

    • Implement network analysis using tools like:
      a. Weighted gene co-expression network analysis (WGCNA)
      b. Bayesian network inference
      c. Multi-omics factor analysis (MOFA)

    • Develop causal models linking genetic perturbation to phenotypic outcomes

    • Use machine learning approaches to identify key signatures associated with NMB0183 function

  • Validation experiments:

    • Confirm key pathways using targeted gene knockouts

    • Implement CRISPR interference for temporal control of gene expression

    • Use chemical inhibitors of identified pathways to validate predictions

    • Develop reporter strains to monitor pathway activation in real-time

When designing multi-omics studies, researchers should ensure proper statistical design, including consideration of sample size, biological replicates, and appropriate controls as outlined in experimental design principles . Analysis should account for potential strain-to-strain variation, as genetic diversity studies have shown significant variation among meningococcal isolates .

What are the optimal expression systems and conditions for producing functional recombinant NMB0183 for structural studies?

Methodological approach:

  • Expression system selection:

    • Prokaryotic systems:

      • E. coli BL21(DE3) for high-yield expression

      • E. coli SHuffle or Origami strains for enhanced disulfide bond formation

      • Cell-free protein synthesis for potentially toxic proteins

    • Eukaryotic alternatives:

      • Pichia pastoris for proper folding of complex proteins

      • Insect cell expression for mammalian-like post-translational modifications

      • Mammalian expression for authentic human-like glycosylation

  • Optimization strategies:

    • Implement factorial design experiments testing:
      a. Induction temperature (16°C, 25°C, 37°C)
      b. Inducer concentration (0.1-1.0 mM IPTG)
      c. Induction duration (4h, 8h, overnight)
      d. Media composition (LB, TB, auto-induction)

    • Assess protein solubility and yield using SDS-PAGE and Western blotting

    • Screen buffer conditions using differential scanning fluorimetry

  • Construct design considerations:

    • Design multiple constructs with:
      a. Various affinity tags (His, GST, MBP, SUMO)
      b. Different tag positions (N-terminal vs. C-terminal)
      c. Inclusion of TEV protease cleavage sites
      d. Domain truncations based on structural predictions

  • Protein quality assessment:

    • Validate protein folding using circular dichroism

    • Assess oligomeric state using size-exclusion chromatography

    • Confirm zinc incorporation using inductively coupled plasma mass spectrometry

    • Evaluate homogeneity via dynamic light scattering

For structural studies, researchers should consider following the buffer optimization approach using Tris-based buffer with 50% glycerol as indicated in the product specifications , but must be prepared to screen numerous conditions for crystallization or NMR studies.

What statistical approaches are most appropriate for analyzing experimental data related to NMB0183 function in diverse meningococcal strains?

Methodological approach:

  • Experimental design considerations:

    • Implement nested or factorial designs to account for strain and condition variations

    • Calculate appropriate sample sizes through power analysis

    • Include appropriate technical and biological replicates

    • Control for batch effects through randomization and blocking

  • Statistical analysis framework:

    • For comparing NMB0183 variants across strains:
      a. Analysis of variance (ANOVA) for multiple group comparisons
      b. Mixed linear models for nested/hierarchical data
      c. Non-parametric alternatives when normality assumptions are violated

    • For genomic associations:
      a. Implement linear mixed models to account for population structure
      b. Apply multiple testing correction appropriate to hypothesis
      c. Consider statistical thresholds based on number of independent tests

  • Advanced statistical approaches:

    • For phenotype-genotype associations:
      a. Use SNP-based heritability analyses with genomic relatedness matrices
      b. Implement simulation-based power calculations
      c. Consider Bayesian approaches for complex trait analysis

    • For multivariate outcomes:
      a. Principal component analysis for dimensionality reduction
      b. MANOVA for multiple outcome variables
      c. Structural equation modeling for causal pathway analysis

  • Data visualization and reporting:

    • Generate appropriate visualizations (Manhattan plots, Q-Q plots)

    • Report effect sizes with confidence intervals, not just p-values

    • Include detailed methods section with statistical software and parameters

    • Make raw data available for reproducibility

When designing experiments with multiple meningococcal strains, researchers should note the importance of accounting for population structure, as demonstrated in genome-wide association studies of N. meningitidis . Statistical approaches should be tailored to the specific experimental questions and data characteristics.

How can researchers effectively design CRISPR-Cas9 based strategies for genetic manipulation of NMB0183 in Neisseria meningitidis?

Methodological approach:

  • CRISPR system design:

    • Select appropriate Cas9 variant (SpCas9, SaCas9) for N. meningitidis

    • Design custom promoters suitable for meningococcal expression

    • Develop efficient delivery systems (plasmid transformation, conjugation)

    • Implement inducible Cas9 expression to minimize toxicity

  • sgRNA design strategy:

    • Target multiple sites within NMB0183 gene using prediction algorithms

    • Evaluate off-target potential against meningococcal genome

    • Design sgRNAs with optimal GC content and minimal secondary structure

    • Include PAM-proximal seed region specificity checks

  • Repair template design:

    • For gene knockout:
      a. Design homology arms (500-1000bp) flanking target region
      b. Include selectable markers (antibiotic resistance)
      c. Add unique restriction sites for screening

    • For precise editing:
      a. Introduce silent mutations to prevent re-cutting
      b. Design mutations that preserve protein folding
      c. Consider codon optimization for expression

  • Screening and validation:

    • Implement PCR-based screening strategies for edited clones

    • Confirm edits by Sanger sequencing

    • Validate phenotypic consequences using functional assays

    • Perform whole genome sequencing to check for off-target effects

When implementing CRISPR-Cas9 in N. meningitidis, researchers should consider strain-specific differences in transformation efficiency and DNA uptake sequences. Previous genetic manipulation studies in N. meningitidis have used transposon mutagenesis , but CRISPR-Cas9 offers potential advantages for precise genetic manipulation.

How can researchers address challenges in determining the biological significance of NMB0183 for vaccine development?

Methodological approach:

  • Challenge: Limited understanding of natural variation

    • Solution:

      • Implement systematic sequencing of NMB0183 across diverse clinical isolates

      • Use genetic Meningococcal Antigen Typing System (gMATS) approach

      • Develop computational tools to predict cross-reactive epitopes

      • Create a database of NMB0183 sequence variants linked to clinical outcomes

  • Challenge: Unknown contribution to protective immunity

    • Solution:

      • Develop animal models appropriate for testing NMB0183-based immunity

      • Implement serum bactericidal assays using human complement

      • Measure antibody responses in convalescent sera from patients

      • Compare protection against diverse meningococcal isolates

  • Challenge: Integration with existing vaccine components

    • Solution:

      • Test NMB0183 in combination with established antigens (FHbp, NadA, NHBA)

      • Evaluate potential interference or synergy with existing vaccine components

      • Implement factorial design experiments to optimize antigen combinations

      • Develop rational adjuvant strategies for optimal immune presentation

  • Challenge: Translating animal studies to human prediction

    • Solution:

      • Develop in vitro correlates of protection using human immune cells

      • Use human tissue models for evaluating antibody functionality

      • Implement systems vaccinology approaches to identify response biomarkers

      • Design challenge studies in appropriate animal models

When evaluating NMB0183 for vaccine potential, researchers should consider that current MenB vaccines target outer membrane proteins that elicit broad protective responses . The development process should include strain coverage prediction methods similar to those used for existing vaccines, where predicted coverage has been estimated to be around 62.7% in some populations .

What approaches can researchers use to resolve conflicting data regarding NMB0183 function across different experimental systems?

Methodological approach:

  • Systematic review of methodological differences:

    • Create a comprehensive comparison table of experimental conditions

    • Identify key variables that differ between studies (strain backgrounds, media, assays)

    • Implement meta-analysis approaches where appropriate

    • Develop standardized protocols for key assays

  • Direct experimental comparison:

    • Design experiments that directly test conflicting hypotheses in parallel

    • Use identical strains, reagents, and protocols across laboratories

    • Implement blinded analysis to reduce confirmation bias

    • Conduct inter-laboratory validation studies

  • Integration of multiple data types:

    • Combine data from different experimental approaches:
      a. Genetic (gene deletion, complementation)
      b. Biochemical (in vitro activity assays)
      c. Structural (protein interaction studies)
      d. Systems-level (transcriptomics, proteomics)

    • Develop models that can account for apparently conflicting observations

    • Identify conditions under which different functions predominate

  • Alternative hypothesis generation:

    • Consider multifunctional roles for NMB0183

    • Evaluate strain-specific differences as explanations

    • Assess impact of experimental conditions on protein function

    • Develop new experimental systems to reconcile divergent results

When addressing conflicting data, researchers should consider implementing robust experimental design principles as outlined in "Experimental Design and Data Analysis for Biologists" , ensuring appropriate statistical power, biological replicates, and controls for confounding variables.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.