Recombinant Neisseria meningitidis serogroup B Uncharacterized protein NMB2020 (NMB2020)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NMB2020; Uncharacterized protein NMB2020
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
NMB2020
Target Protein Sequence
MQHDVYDYTAHTVSKNTVLQKTYRLLGFSFIPASAGAALAANAGFNFYAAFGSRWIGFAV VLAFFYGMIHFIEKNRYSNTGVTLLMVFTFGMGVLIGPVLQYALHIADGAKIVGIAAAMT AAVFLTMSALARRTRLDMNALGRFLTVGAVILMVAVVANLFLGIPALALTISAGFVLFSS LMIMWQVRTVIDGGEDSHISAALTLFISLYNIFSSLLNILLSLNGED
Uniprot No.

Target Background

Database Links

KEGG: nme:NMB2020

STRING: 122586.NMB2020

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of NMB2020 within the Neisseria meningitidis serogroup B genome?

NMB2020 is located within the highly dynamic genome of Neisseria meningitidis, a bacterium characterized by remarkable genetic flexibility and frequent recombination events. Within the serogroup B lineage, particularly those belonging to sequence type 4821 clonal complex (CC4821), genomic organization shows significant variability at multiple loci . When analyzing the genomic context of NMB2020, researchers should consider that N. meningitidis genomes contain abundant and diverse repetitive DNA sequences that facilitate various recombination mechanisms .

Genomic analysis should include examination of:

  • Flanking regions for potential regulatory elements

  • Proximity to known recombination hotspots

  • Presence of repetitive DNA sequences that might influence expression

  • Synteny comparison with related Neisseria species

What experimental approaches are most effective for expressing recombinant NMB2020 protein?

When expressing recombinant Neisseria proteins, including uncharacterized proteins like NMB2020, several methodological considerations are essential. The experimental design should account for the unique characteristics of meningococcal proteins . The following expression systems have proven effective for Neisseria proteins:

Expression SystemAdvantagesLimitationsRecommended Tags
E. coli BL21(DE3)High yield, simple culturingPotential improper foldingHis6, MBP
E. coli SHuffleEnhanced disulfide bond formationLower yieldHis6, SUMO
Cell-free systemsAvoids toxicity issuesHigher costHis6, GST
Mammalian cellsBetter post-translational modificationsComplex protocol, expensiveFc, FLAG

When designing expression protocols, researchers should implement control experiments to validate protein folding and function. The natural genetic flexibility of Neisseria meningitidis may provide clues about the protein's tolerance to modifications .

How can researchers differentiate between NMB2020 variants across different CC4821 strains?

Differentiating between NMB2020 variants requires a methodological approach that accounts for the significant genomic variability observed across N. meningitidis strains. Phylogenetic analysis of CC4821 strains has revealed that they cluster into closely related groups, with both serogroup B and C strains appearing in each cluster .

To differentiate NMB2020 variants, researchers should employ:

  • Whole genome sequencing followed by comparative genomic analysis

  • Multi-locus sequence typing (MLST) to establish strain relationships

  • Characterization of outer membrane protein genes, similar to approaches used for PorA, PorB, and FetA genotyping

  • Analysis of potential recombination events affecting the gene of interest

When analyzing sequence data, researchers should be aware that several recombination events may have occurred at uncertain breakpoints within CC4821 strains, potentially affecting the NMB2020 locus .

What role might NMB2020 play in the recombination processes that facilitate serogroup switching in N. meningitidis?

The potential involvement of NMB2020 in recombination processes requires sophisticated investigation given the complex recombination landscape in N. meningitidis. Research has demonstrated that CC4821 serogroup C N. meningitidis is likely the origin of pathogenic CC4821 serogroup B strains, suggesting significant recombination at the capsule locus . When examining NMB2020's possible role in this process, researchers should consider:

Methodological approach should include:

  • Identification of recombination hotspots near the NMB2020 locus

  • Analysis of recombination rates across different lineages of N. meningitidis

  • Comparison of NMB2020 sequence variation in relation to capsule locus variability

  • Experimental manipulation of NMB2020 to assess effects on recombination frequency

Research has shown that meningococcal lineages can exhibit orders of magnitude differences in recombination rates . Therefore, when investigating NMB2020's potential role, researchers must account for lineage-specific recombination phenotypes that might confound the analysis.

How can Markov modeling be applied to predict the evolutionary trajectory of NMB2020 within circulating N. meningitidis populations?

Markov modeling provides a powerful framework for predicting evolutionary trajectories of proteins like NMB2020 within bacterial populations. Drawing from approaches used in other health science contexts, researchers can develop models with discrete states representing different protein variants .

A Markov model for NMB2020 evolution should include:

  • Definition of discrete protein states (variants) observed in circulation

  • Transition probabilities between states based on:

    • Recombination rates (which vary by lineage)

    • Selection pressures

    • Geographical and temporal factors

  • Cycle length determination appropriate for meningococcal evolution

Model ParameterBaseline ValueLower RangeUpper RangeData Source
Transition probability between major variantsVariable-25%+25%Population genomics
Selection coefficientStrain-dependentMin observedMax observedFitness assays
Recombination rateLineage-specificOrders of magnitude variationGenomic analysis

The model should incorporate sensitivity analysis to test robustness of predictions, varying parameters within biologically plausible ranges (±25% of baseline values) .

What approaches can resolve contradictory findings regarding NMB2020 function across different experimental systems?

Resolving contradictory findings requires systematic investigation of factors that might contribute to experimental variability. When examining inconsistent results regarding NMB2020 function, researchers should implement:

  • Standardized experimental design with appropriate controls:

    • Include positive and negative controls for each assay

    • Standardize protocols across laboratories

    • Implement blind/double-blind methodologies when appropriate

  • Multi-system validation:

    • Test function in multiple expression systems

    • Compare in vitro and in vivo findings

    • Assess function across different CC4821 lineages with varying recombination phenotypes

  • Statistical analysis framework:

    • Apply robust statistical methods appropriate for the data type

    • Calculate effect sizes and confidence intervals

    • Consider meta-analysis of multiple independent studies

  • Examination of strain-specific factors:

    • Analysis of sequence variations that might affect function

    • Assessment of genomic context differences

    • Consideration of lineage-specific phenotypes

When reconciling contradictory data, researchers should consider that N. meningitidis shows significant variation in recombination rates between different regions of its genome, which might affect NMB2020 expression or function in a strain-dependent manner .

What experimental design considerations are critical when studying the impact of NMB2020 knockouts on N. meningitidis virulence?

Designing experiments to study NMB2020 knockouts requires careful consideration of multiple factors that might influence virulence assessments. The experimental approach should follow established principles of experimental design while accounting for the specific challenges of working with N. meningitidis .

Critical design elements include:

  • Selection of appropriate control strains:

    • Include parent strain (wild-type)

    • Consider complemented knockout strains

    • Include strains with knockouts of proteins with known virulence effects

  • Randomization and blinding:

    • Implement randomized experimental design

    • Use blinded assessment of outcomes when possible

    • Apply block design when necessary to control for batch effects

  • Comprehensive virulence assessment:

    • In vitro adhesion and invasion assays

    • Serum resistance testing

    • Animal models of colonization and invasion

    • Transcriptomic analysis to identify compensatory mechanisms

  • Consideration of strain background effects:

    • Test knockouts in multiple lineages with different recombination rates

    • Assess effect in both hyperinvasive and less virulent backgrounds

    • Consider testing in both serogroup B and C backgrounds of CC4821

Each experimental condition should be tested with adequate biological and technical replicates to ensure statistical power for detecting biologically meaningful differences.

How can researchers effectively distinguish between direct effects of NMB2020 and indirect effects mediated through recombination or other processes?

Distinguishing direct from indirect effects requires careful experimental design and analysis that accounts for the complex genomic landscape of N. meningitidis. Researchers should implement a multi-faceted approach:

  • Time-course experiments:

    • Monitor changes immediately following NMB2020 manipulation

    • Track long-term adaptation through multiple passages

    • Compare timescales of observed effects with known recombination rates

  • Multi-omic integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map immediate regulatory network responses

    • Identify delayed secondary responses indicative of indirect effects

  • Recombination rate monitoring:

    • Measure recombination rates in wild-type vs. NMB2020-manipulated strains

    • Assess changes in specific recombination hotspots

    • Compare with lineage-specific baseline recombination phenotypes

  • Genetic interaction mapping:

    • Create double knockouts with known pathway components

    • Apply synthetic genetic array approaches adapted for N. meningitidis

    • Quantify epistatic interactions to place NMB2020 in functional networks

When interpreting results, researchers should consider that N. meningitidis population structure correlates with genome flexibility, with some lineages being orders of magnitude more recombinant than others . This variation may influence the observed effects of NMB2020 manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.