Recombinant Neisseria meningitidis serogroup B UPF0761 membrane protein NMB0524 (NMB0524)

Shipped with Ice Packs
In Stock

Description

Functional Insights

NMB0524 is hypothesized to contribute to meningococcal virulence through:

  • Membrane integrity: Structural role in maintaining outer membrane stability .

  • Host interaction: Potential involvement in nutrient uptake or immune evasion .

  • Immunogenicity: Elicits IgG responses in preclinical studies, though weaker compared to other outer membrane proteins like BamC or RmpM .

Studies using OMV (outer membrane vesicle) vaccines revealed that NMB0524 is a minor antigenic component, with limited antibody response in human trials compared to dominant targets like FetA or PorA .

Vaccine Development

NMB0524 was included in a panel of 91 outer membrane proteins (OMPs) screened against antisera from individuals vaccinated with MenPF-1, an OMV-based meningococcal B vaccine :

  • Seroconversion rate: Only 14–56% of recipients showed a ≥3-fold IgG increase post-vaccination .

  • Comparison to other antigens: Less immunogenic than BamC (56% response rate) or OpcA .

Expression and Purification Challenges

  • Solubility: Requires denaturing conditions (e.g., urea) for extraction, potentially disrupting conformational epitopes .

  • Stability: Sensitive to freeze-thaw cycles; optimal storage at -80°C in glycerol-containing buffers .

Future Directions

While NMB0524’s vaccine potential remains underexplored, advancements in adjuvant systems or structural stabilization (e.g., nanodiscs or liposomes) could enhance its immunogenicity . Further studies are needed to clarify its role in meningococcal pathogenesis and utility in multi-component vaccines .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
NMB0524; UPF0761 membrane protein NMB0524
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Neisseria meningitidis serogroup B (strain MC58)
Target Names
NMB0524
Target Protein Sequence
MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFRRGFDSRGRFDDVLKILLLL DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQGWVLKTGADSIELNEL FKLFVYRPLPVERDHVNQAVDAVMTPCLQTLNMTLAEFDAQAKKRQ
Uniprot No.

Target Background

Database Links

KEGG: nme:NMB0524

STRING: 122586.NMB0524

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage conditions for maintaining NMB0524 stability?

For optimal stability, recombinant NMB0524 should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use. For extended storage periods, maintaining the protein at -20°C to -80°C is recommended . Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided; instead, working aliquots should be prepared and stored at 4°C for up to one week to minimize degradation .

When designing experiments, researchers should account for the protein's stability timeline by preparing fresh working solutions as needed and implementing appropriate controls to monitor potential degradation effects on experimental outcomes.

How does the expression system affect the quality of recombinant NMB0524?

The choice of expression system significantly impacts the quality, yield, and functionality of recombinant NMB0524. As a complex membrane protein, NMB0524 requires an expression system capable of properly folding and processing transmembrane proteins. Expression in E. coli systems often leads to inclusion body formation, necessitating complex refolding protocols that may compromise protein structure and function.

Alternative expression systems, such as insect or mammalian cells, may provide better folding environments but at reduced yields. Recent advances in membrane protein expression techniques, including specialized E. coli strains with enhanced membrane protein processing capabilities, offer promising alternatives for improved yields while maintaining native-like structure.

What approaches are most effective for solubilizing NMB0524 while preserving its structural integrity?

Traditional membrane protein solubilization methods using detergents present significant challenges for NMB0524, often resulting in protein destabilization or incomplete solubilization. Recent advances in protein engineering technology, particularly the development of Water-soluble RFdiffused Amphipathic Proteins (WRAPs), offer promising alternatives .

WRAP technology represents a deep learning-based design approach that creates de novo proteins specifically engineered to surround the hydrophobic surfaces of membrane proteins. This renders them stable and water-soluble without requiring detergents, while crucially preserving the target protein's native sequence, fold, and function .

For NMB0524 research, implementing WRAP technology could significantly enhance structural and functional studies by:

  • Improving protein stability in aqueous solutions

  • Facilitating purification and handling procedures

  • Enabling more accurate structural characterization through techniques like cryo-EM

  • Preserving the antigenic epitopes critical for immunological studies

This approach has demonstrated success with both beta-barrel outer membrane and helical multi-pass transmembrane proteins, suggesting its applicability to NMB0524 regardless of its specific membrane topology .

How can contradictory functional data for NMB0524 be reconciled in research contexts?

When researchers encounter contradictory functional data regarding NMB0524, systematic analysis should be implemented following these methodological steps:

  • Experimental condition standardization: Compare buffer compositions, protein concentrations, and assay conditions across studies. Minor variations in pH, ionic strength, or the presence of specific ions can significantly alter membrane protein behavior.

  • Protein preparation evaluation: Assess differences in expression systems, purification methods, and solubilization approaches. The presence or absence of specific detergents, lipids, or stabilizing agents can dramatically impact protein conformation and activity.

  • Genetic variation analysis: Compare the exact gene sequences used across studies, as strain-specific variations in NMB0524 may exist even within serogroup B isolates.

  • Combined methodological approach: Implement multiple orthogonal techniques to characterize the same functional property, providing stronger evidence for a particular functional model.

  • Computational modeling: Utilize structural prediction and molecular dynamics simulations to generate hypotheses that might explain apparently contradictory results based on subtle conformational differences.

Researchers should present a comprehensive comparison table of experimental conditions when discussing contradictory findings, facilitating transparent evaluation of methodological differences that may account for discrepancies.

What are the optimal techniques for studying NMB0524 interactions with host immune factors?

Investigating NMB0524 interactions with host immune factors requires specialized techniques that preserve the protein's native conformation while enabling sensitive detection of binding events. A multi-method approach is recommended:

Surface Plasmon Resonance (SPR): This label-free technique allows real-time monitoring of protein-protein interactions with high sensitivity. For NMB0524, the protein should be immobilized using oriented coupling strategies that preserve accessible epitopes.

Enzyme-Linked Immunosorbent Assay (ELISA): Modified protocols using recombinant NMB0524 can assess antibody binding specificity and affinity. When designing these assays, researchers should:

  • Ensure proper protein orientation on the solid phase

  • Include appropriate blocking steps to minimize non-specific binding

  • Validate with multiple antibody sources to confirm epitope accessibility

Flow Cytometry with Reconstituted Proteoliposomes: This technique enables assessment of antibody binding to NMB0524 in a membrane context, better approximating the native environment.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This approach can identify specific regions of NMB0524 involved in immune factor interactions by monitoring changes in hydrogen-deuterium exchange rates upon complex formation.

What experimental design ensures valid comparisons between wild-type and mutant NMB0524 variants?

Robust experimental design for comparing wild-type and mutant NMB0524 variants requires careful attention to multiple variables. The following methodological framework should be implemented:

  • Expression standardization: Express all protein variants using identical systems, induction conditions, and purification protocols to minimize system-derived variability.

  • Quantitative validation: Employ multiple quantification methods (e.g., BCA assay, SDS-PAGE with densitometry, and amino acid analysis) to confirm protein concentrations across variants.

  • Structural integrity assessment: Before functional comparisons, verify that mutations haven't caused gross structural alterations using circular dichroism spectroscopy or limited proteolysis.

  • Paired experimental design: Always test wild-type and mutant variants simultaneously under identical conditions to control for day-to-day experimental variation.

  • Functional assay selection: Choose assays that directly measure the specific function hypothesized to be affected by the mutation rather than indirect readouts.

  • Statistical power calculation: Determine appropriate sample sizes based on preliminary data variability to ensure sufficient statistical power for detecting biologically relevant differences.

The following table presents a methodological framework for comparative studies:

ParameterRecommended ApproachValidation Method
Expression systemIdentical for all variantsWestern blot verification
Purification methodIMAC followed by size exclusionSDS-PAGE purity assessment
Protein quantificationBCA assay with BSA standard curveCross-validation with amino acid analysis
Structural assessmentFar-UV circular dichroismThermal stability comparison
Functional assessmentDirect binding assaysMultiple readouts (fluorescence, SPR)
Statistical analysisPaired t-tests with multiple comparison correctionPower analysis justification

How should researchers properly present NMB0524 research data in publications?

Effective presentation of NMB0524 research data requires adherence to scientific writing principles while addressing the specific challenges of membrane protein research. Following these guidelines will enhance clarity and reproducibility:

  • Methods section thoroughness: Include detailed descriptions of expression systems, purification methods, and buffer compositions. For NMB0524, specifically document:

    • Expression vector and host strain

    • Induction conditions

    • Membrane extraction procedures

    • Detergent types and concentrations

    • Stabilizing additives

  • Results presentation: Begin with expression yields and protein purity before functional data. Present data in a logical progression from basic characterization to complex functional analyses .

  • Data visualization: Use appropriate graphical formats - tables for precise numerical values, and charts or graphics for illustrating trends and relationships. Ensure tables and figures are self-explanatory with four main components: title, columns, rows, and footnotes when necessary .

  • Statistical analysis: Clearly state statistical methods employed and their justification. For membrane protein work, consider the inherent variability and document sample sizes, replicates, and statistical power.

  • Control experiments: Explicitly document all control experiments performed to validate NMB0524 functionality, particularly those demonstrating that the recombinant protein maintains native-like properties.

When writing the results section, use past tense and integrate interpretation with data presentation rather than presenting raw data alone . For example:

Poor: "Mean binding affinity of NMB0524 for Factor H was 25nM before lipid reconstitution and 8nM after reconstitution."

Better: "NMB0524 demonstrated a three-fold increase in Factor H binding affinity following lipid reconstitution (from 25nM to 8nM), suggesting the importance of a lipid environment for proper protein conformation."

What emerging technologies can advance structural studies of NMB0524?

Several cutting-edge technologies are transforming membrane protein research and can be specifically applied to NMB0524 structural studies:

Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology by eliminating the need for crystallization. For NMB0524, cryo-EM combined with the WRAP solubilization technology discussed earlier can yield high-resolution structural data. Recent studies have demonstrated the feasibility of this approach, achieving resolution as high as 4.0Å for membrane proteins in WRAP complexes .

Single-Particle Analysis: This computational approach can be applied to cryo-EM data to reconstruct the 3D structure of NMB0524 from multiple 2D projections, particularly valuable when crystal formation is challenging.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides insights into protein dynamics and solvent accessibility, complementing static structural data with information about flexible regions and conformational changes.

AlphaFold and RoseTTAFold: These AI-based protein structure prediction tools have shown remarkable accuracy, even for membrane proteins. Researchers can use these computational approaches to generate structural models of NMB0524 that can guide experimental design and interpretation.

Lipid Nanodisc Technology: This approach reconstitutes membrane proteins into disc-shaped lipid bilayers surrounded by scaffold proteins, maintaining a native-like environment while enabling solution-state studies.

How can researchers integrate NMB0524 structural data with functional insights?

Effective integration of structural and functional data for NMB0524 requires a systematic approach:

  • Structure-guided mutagenesis: Use structural information to design targeted mutations at predicted functional sites, followed by comprehensive functional assays to validate these predictions.

  • Computational simulations: Employ molecular dynamics simulations to model how structural elements of NMB0524 might contribute to observed functions, particularly membrane interactions and potential conformational changes.

  • Epitope mapping: Correlate antibody binding sites with structural features to understand immunologically relevant domains, especially for vaccine development applications.

  • Evolutionary analysis: Map sequence conservation patterns onto structural models to identify functionally constrained regions that may represent essential protein activities.

  • Protein-protein interaction prediction: Use docking algorithms with the NMB0524 structure to predict potential binding partners in host-pathogen interactions.

The successful integration of these approaches provides a comprehensive understanding of NMB0524 that can inform therapeutic development strategies, particularly vaccine design targeting Neisseria meningitidis serogroup B.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.