Recombinant Neisseria meningitidis serogroup C / serotype 2a Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

Glycerol-3-phosphate acyltransferase (PlsY) catalyzes the initial step of phospholipid biosynthesis by transferring an acyl group to the sn-1 position of glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA). This reaction is critical for synthesizing membrane lipids and extracellular lipid polyesters, which contribute to bacterial survival and pathogenicity .

Catalytic Features:

  • Substrate Specificity: Uses acyl-phosphate donors (e.g., acyl-ACP) instead of acyl-CoA, a trait distinguishing bacterial PlsY from eukaryotic GPATs .

  • Regiospecificity: Acylates G3P at the sn-1 position, producing 1-acyl-LPA .

3.1. Role in Lipid Biosynthesis

PlsY is integral to synthesizing phospholipids that form the outer membrane, which houses virulence factors like capsular polysaccharides and LPS. In N. meningitidis, lipid A (a component of LPS) is a potent endotoxin linked to septic shock .

3.2. Genomic Context

The plsY gene resides in the cps (capsular polysaccharide synthesis) locus, which is clade-specific and associated with phylogenetic lineages (e.g., clonal complex 32/269) . Serogroup-specific RMS (restriction-modification systems) may influence horizontal gene transfer of plsY, impacting virulence evolution .

3.3. Experimental Insights

  • Recombinant Expression: PlsY homologs (e.g., serogroup A) are expressed in E. coli with high purity (>90%) and retain enzymatic activity in vitro .

  • Pathogenic Implications: Accumulation of N. meningitidis LPS in organs like the lungs correlates with severe septic shock, underscoring the importance of lipid metabolism in virulence .

Table 2: GPAT Classes and Functions

ClassLocalizationSubstrateRole
PlsYBacterial membraneAcyl-phosphatePhospholipid biosynthesis
GPAT1-4Mitochondria/ERAcyl-CoATriglyceride/phospholipid synthesis
GPAT5-8ER/plastidsAcyl-ACPCutin/suberin formation in plants

Knowledge Gaps and Future Directions

Direct studies on serogroup C/serotype 2a PlsY are lacking. Key unresolved questions include:

  • Structural differences between serogroup-specific PlsY variants.

  • Impact of PlsY on antibiotic resistance or vaccine development.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; NMC1026; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
plsY
Target Protein Sequence
MFNIPAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGATNVLRSGKKKAAVLTLLGD AAKGLVAVLLARVLQEPLGLSDSAIAAVALAALVGHMWPVFFGFKGGKGVATALGVLLAL SPATALVCALIWLVMAFGFKVSSLAALTATIAAPLAALFFMPHLSWIWATLLIALLVLFR HKSNISNLLKGKEGKIGEKR
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: nmc:NMC1026

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Glycerol-3-phosphate acyltransferase (plsY) in Neisseria meningitidis?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in Neisseria meningitidis that catalyzes the first step in phospholipid biosynthesis, specifically the acylation of glycerol-3-phosphate to form lysophosphatidic acid. This enzyme plays an essential role in the bacterial cell membrane formation and integrity, directly impacting pathogen viability and virulence. N. meningitidis is a gram-negative bacterium responsible for invasive meningococcal disease, associated with high fatality rates and serious lifelong disabilities among survivors . The plsY enzyme represents a potential target for antimicrobial development due to its essential nature in bacterial membrane synthesis.

How do serogroup C and serotype 2a classifications impact plsY expression and function?

Neisseria meningitidis serogroups are classified based on their capsular polysaccharide antigens, with serogroup C being one of the major disease-causing groups. Serotype 2a refers to the outer membrane protein classification. While these classifications primarily affect surface structures, they can indirectly influence plsY expression through regulatory networks that respond to environmental conditions. Genetic characterization studies of N. meningitidis have shown that isolates from different serogroups may exhibit varying gene expression patterns, potentially including differences in phospholipid biosynthesis enzymes like plsY . Researchers analyzing N. meningitidis isolates from blood and cerebrospinal fluid often employ multilocus restriction typing (MLRT) and whole-genome sequencing to identify strain-specific characteristics that may impact enzyme function .

What expression systems are most suitable for recombinant plsY production?

The most effective expression system for recombinant plsY production from N. meningitidis is the Escherichia coli BL21(DE3) strain, which accounts for 65% of industrial enzyme expression cases . This B-derivative strain offers several advantages for membrane protein expression: it is deficient in Lon and OmpT proteases (protecting misfolded proteins from degradation), has a short doubling time of approximately 20 minutes, and employs the T7 expression system that generates stable protein products at high titers . For plsY specifically, which is a membrane-associated enzyme, specialized strains like ArcticExpress (DE3) may be considered when facing folding challenges, as they promote proper folding under low-temperature conditions, increasing solubility .

Expression strainCommercial supplierBenefits for plsY expressionApplication scenario
BL21(DE3)Various suppliersHigh expression yields, protease deficiencyStandard expression conditions
ArcticExpress (DE3)Agilent TechnologiesLow-temperature expression with active molecular chaperonesWhen protein solubility is an issue
Rosetta(DE3)Merck KGaASupplies rare tRNAs to overcome codon biasWhen codon optimization hasn't been performed
BL21(DE3)pLysSVarious suppliersLower background expressionIf plsY expression proves toxic to host cells

What are the optimal conditions for soluble expression of recombinant N. meningitidis plsY?

The optimization of soluble expression for membrane-associated enzymes like N. meningitidis plsY requires a multifaceted approach. Research indicates that lowering the induction temperature to 15-20°C significantly increases the solubility of membrane-associated proteins by reducing the rate of protein synthesis and allowing more time for proper folding. Additionally, employing specialized strains like ArcticExpress (DE3) that co-express cold-active chaperonins Cpn10 and Cpn60 can enhance proper folding at low temperatures . Expression studies should systematically evaluate the impact of varying IPTG concentrations (typically in the range of 0.1-1.0 mM), with lower concentrations often favoring solubility over yield. For plsY specifically, incorporating 0.5% glycerol in the growth medium can provide additional substrate for the enzyme and potentially stabilize its folding intermediates. Experimental designs should include time-course analysis of induction periods, as longer induction times at lower temperatures (16-24 hours) generally produce better results for membrane proteins compared to standard protocols.

How can one efficiently purify recombinant plsY while maintaining enzymatic activity?

Purification of recombinant plsY while preserving its enzymatic activity requires careful consideration of the protein's membrane-associated nature. A two-phase extraction approach has proven most effective: first, extraction of the membrane fraction using a mild detergent buffer (typically containing 1% n-dodecyl-β-D-maltoside or 0.5% CHAPS), followed by immobilized metal affinity chromatography (IMAC) using a histidine tag. Critical parameters affecting purification efficiency and enzyme activity include:

  • Buffer composition: 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, and 5 mM β-mercaptoethanol

  • Detergent concentration: Must be above critical micelle concentration but low enough to prevent denaturation

  • Imidazole gradient: A stepwise elution with 20 mM, 50 mM, and 250 mM imidazole separates non-specific binding proteins

  • Temperature maintenance: All purification steps should be performed at 4°C

Activity preservation can be monitored using a radiometric assay measuring the incorporation of [14C]glycerol-3-phosphate into lysophosphatidic acid. Purified enzyme should be stored in buffer containing 10% glycerol at -80°C, avoiding repeated freeze-thaw cycles that significantly decrease activity.

What genetic modifications enhance recombinant plsY expression and solubility?

Several genetic modifications can substantially improve the expression and solubility of recombinant N. meningitidis plsY:

  • Codon optimization: Analyzing the codon usage bias between N. meningitidis and the E. coli expression host identifies rare codons that may impede translation. Optimization should focus particularly on AGA/AGG (arginine), AUA (isoleucine), and CUA (leucine) codons, which are often limiting in E. coli . If complete gene synthesis is not feasible, using Rosetta strains containing plasmids that express the rare tRNAs can alleviate this issue.

  • Fusion tags: N-terminal fusion with solubility-enhancing tags has demonstrated significant improvement in plsY expression. The most effective tags include:

    • Thioredoxin (Trx): A 12 kDa tag that enhances disulfide bond formation

    • Maltose-binding protein (MBP): A 42 kDa tag that serves as both solubility enhancer and affinity tag

    • NusA: A 55 kDa tag particularly effective for membrane proteins

  • Signal sequence modifications: Removing or replacing the native signal sequence with E. coli-optimized sequences can improve targeting and folding.

  • Truncation constructs: Systematic testing of N- and C-terminal truncations can identify minimal functional domains with improved solubility while maintaining catalytic activity.

The effectiveness of these modifications should be evaluated using a structured experimental design approach rather than trial-and-error testing, as model-based approaches have proven successful in predicting the effectiveness of solubility-enhancing strategies .

How should researchers design experiments to characterize plsY kinetics and substrate specificity?

Comprehensive characterization of N. meningitidis plsY kinetics and substrate specificity requires a systematic experimental approach that accounts for the enzyme's membrane-associated nature. A robust experimental design should include:

  • Substrate preparation: Both natural substrates (glycerol-3-phosphate and acyl-ACP) and synthetic analogs should be tested. For acyl donors, a homologous series of acyl-ACPs with varying chain lengths (C8-C18) and degrees of saturation provides insight into substrate preference.

  • Reaction conditions matrix:

    • pH range: 6.0-9.0 (50 mM buffer systems)

    • Temperature range: 25-45°C

    • Divalent cation concentrations: Mg2+, Mn2+, Ca2+ (0-10 mM)

    • Detergent types and concentrations

  • Kinetic parameter determination: Initial velocity measurements using radiometric or fluorescent assays to determine Km and Vmax values for each substrate combination.

  • Inhibition studies: Testing product inhibition and feedback regulation mechanisms using lysophosphatidic acid and downstream metabolites.

The experimental design should employ a temporally ordered table approach to track changes in enzyme activity under varying conditions, facilitating the identification of temporal patterns in enzyme behavior . This approach is particularly valuable for understanding the process mechanisms of plsY catalysis and identifying optimal reaction conditions.

Substrate combinationpHTemperature (°C)Mg2+ (mM)Km (μM)kcat (s-1)kcat/Km (M-1 s-1)
G3P + C12-ACP7.0375.0[data][data][data]
G3P + C14-ACP7.0375.0[data][data][data]
G3P + C16-ACP7.0375.0[data][data][data]
G3P + C18-ACP7.0375.0[data][data][data]
G3P + C16:1-ACP7.0375.0[data][data][data]

What approaches are most effective for studying plsY structure-function relationships?

Elucidating structure-function relationships of N. meningitidis plsY requires integrating multiple experimental approaches:

  • Site-directed mutagenesis: A systematic alanine-scanning mutagenesis of conserved residues, particularly focusing on predicted catalytic residues and substrate-binding regions, provides direct evidence of their functional importance. Each mutant should be characterized for both expression levels and enzymatic activity.

  • Structural biology techniques:

    • X-ray crystallography: Requires generation of protein crystals, challenging for membrane proteins

    • Cryo-electron microscopy: Increasingly valuable for membrane protein structure determination

    • NMR spectroscopy: Useful for studying protein dynamics and substrate interactions

    • Homology modeling: Leveraging structures of plsY homologs from other bacteria when experimental structures are unavailable

  • Molecular dynamics simulations: In silico analysis of protein flexibility, substrate binding modes, and the effects of mutations on protein stability and function.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions of structural flexibility and conformational changes upon substrate binding.

For these approaches, concept-evidence tables should be employed to ensure systematic grounding of interpretations in empirical evidence, allowing for independent assessment of the extent of empirical support for theoretical claims about structure-function relationships .

How can researchers effectively compare plsY from different N. meningitidis strains and serogroups?

Comparative analysis of plsY across different N. meningitidis strains and serogroups requires a comprehensive phylogenetic and functional approach:

  • Sequence analysis: Multiple sequence alignment of plsY genes from diverse N. meningitidis isolates, focusing on serogroup C and serotype 2a strains compared to other variants. This should include analysis of both coding sequences and promoter regions to identify regulatory differences. Based on MLRT genotyping results, researchers should select distinct strains for additional analysis using whole-genome sequencing .

  • Recombinant expression: Parallel expression of plsY variants from multiple strains under identical conditions to control for expression system variables. The BL21(DE3) expression system is recommended as the primary expression host, given its widespread use in 65% of enzyme expression cases .

  • Enzymatic characterization: Side-by-side kinetic analysis of purified enzymes under standardized conditions, measuring:

    • Substrate preferences

    • Reaction rates

    • Temperature and pH optima

    • Inhibition profiles

  • Structural comparison: Circular dichroism spectroscopy to compare secondary structure elements, and if possible, higher-resolution structural studies.

  • In vivo complementation: Testing the ability of different plsY variants to complement growth defects in conditional knockout strains.

A cross-case comparative table approach should be employed to facilitate systematic and thorough comparisons across variants, allowing for effective display of evidence in support of cross-case variance claims . This structured analysis enables researchers to identify whether sequence variations correlate with functional differences that might impact pathogenicity or antibiotic susceptibility.

What statistical approaches are most appropriate for analyzing plsY enzymatic assay data?

The statistical analysis of plsY enzymatic assay data requires rigorous approaches to account for the complexity and variability inherent in biochemical experiments:

  • Enzyme kinetics modeling: Non-linear regression analysis should be used to fit velocity data to appropriate enzyme kinetic models (Michaelis-Menten, allosteric, or product inhibition). Goodness-of-fit parameters (R² values, residual plots) should be reported alongside Km, Vmax, and kcat values. Analysis of residuals is crucial to validate model selection.

  • Experimental replication requirements:

    • Minimum of three biological replicates (independent enzyme preparations)

    • Three technical replicates per biological replicate

    • Inclusion of appropriate controls (no-enzyme, no-substrate)

  • Statistical tests for comparative analyses:

    • ANOVA with post-hoc tests (Tukey's HSD) for comparing multiple conditions

    • Student's t-test (paired or unpaired as appropriate) for binary comparisons

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when normality assumptions are violated

  • Outlier analysis: Modified Z-score method or Dixon's Q test to identify potential outliers, with clear documentation of any data exclusion criteria.

  • Uncertainty propagation: Proper calculation and reporting of standard errors for derived parameters like kcat/Km.

For enhanced trustworthiness in data analysis, researchers should employ data analysis tables to help keep track of analytical steps and enable reconstruction of the analytical process . This approach ensures transparency in how raw enzymatic data are transformed into meaningful kinetic parameters.

How can researchers address data inconsistencies in plsY structural and functional studies?

Addressing data inconsistencies in plsY research requires a methodical approach to identify sources of variation and resolve apparent contradictions:

  • Systematic evaluation of experimental variables:

    • Expression conditions: Variations in induction parameters, host strain differences, and growth media composition can significantly affect protein quality

    • Purification protocols: Differences in detergent selection, buffer composition, and chromatography methods

    • Assay conditions: Substrate preparation methods, detection systems, and reaction conditions

  • Cross-validation strategies:

    • Multiple assay methodologies: Employing orthogonal techniques (radiometric, spectrophotometric, coupled enzyme assays) to confirm enzymatic activity

    • Independent structural approaches: Combining crystallography, molecular modeling, and biophysical techniques

    • Inter-laboratory validation: Collaboration with other research groups to reproduce key findings

  • Reconciliation frameworks:

    • Create co-occurrence tables to examine whether and how different features tend to co-occur, revealing patterns in the distribution of inconsistencies

    • Develop explanatory models that account for apparent contradictions (e.g., enzyme conformational states, allosteric regulation)

    • Consider strain-specific variations that might explain functional differences

  • Meta-analysis approaches:

    • Systematic review of literature using predefined inclusion criteria

    • Quantitative comparison of published parameters with appropriate normalization

    • Identification of moderator variables that explain differences between studies

When inconsistencies persist despite these approaches, researchers should explicitly acknowledge limitations and uncertainties rather than selectively reporting data that conforms to expectations. This transparency enhances the trustworthiness of the research process and builds confidence in the robustness of findings .

What bioinformatic tools are most valuable for analyzing plsY sequence-structure-function relationships?

The analysis of sequence-structure-function relationships for N. meningitidis plsY benefits from an integrated bioinformatics approach:

  • Sequence analysis tools:

    • Multiple Sequence Alignment: MAFFT or Clustal Omega for identifying conserved residues across bacterial species

    • Phylogenetic analysis: RAxML or MrBayes for evolutionary relationship inference

    • Conservation mapping: ConSurf server for identifying functionally important residues

    • Codon usage analysis: GCUA or CodonW to identify potential expression limitations in heterologous hosts

  • Structural prediction and analysis:

    • Homology modeling: SWISS-MODEL or I-TASSER for generating structural models based on related proteins

    • Molecular docking: AutoDock Vina or HADDOCK for predicting substrate binding modes

    • Molecular dynamics: GROMACS or NAMD for simulating protein dynamics in membrane environments

    • Transmembrane topology prediction: TMHMM or Phobius for membrane protein organization

  • Functional prediction:

    • Active site prediction: 3DLigandSite or CASTp for identifying potential catalytic and binding sites

    • Stability analysis: FoldX or I-Mutant for predicting the impact of mutations

    • Protein-protein interaction prediction: STRING or PSICQUIC for identifying potential interaction partners

  • Integrated analysis frameworks:

    • Structure-based sequence alignments using tools like PROMALS3D

    • Evolutionary trace methods to correlate sequence conservation with structural features

    • Machine learning approaches to predict the impact of mutations on enzyme function

How can recombinant plsY be utilized for antimicrobial drug discovery?

The essential role of plsY in phospholipid biosynthesis makes it an attractive target for novel antimicrobial development against N. meningitidis. A comprehensive drug discovery pipeline centered on this enzyme should incorporate:

  • High-throughput screening approaches:

    • Development of a fluorescence-based assay measuring either substrate consumption or product formation

    • Adaptation to 384-well format for screening compound libraries (10,000-100,000 compounds)

    • Implementation of counter-screens to eliminate false positives and cytotoxic compounds

    • Z-factor calculation to ensure assay robustness (Z' > 0.5 is considered acceptable)

  • Structure-based drug design:

    • Using crystal structures or validated homology models of N. meningitidis plsY

    • Virtual screening of in silico libraries against the substrate binding pocket

    • Fragment-based approaches to identify chemical scaffolds with high ligand efficiency

    • Molecular dynamics simulations to account for protein flexibility

  • Medicinal chemistry optimization:

    • Structure-activity relationship studies on hit compounds

    • Improvement of potency, selectivity, and physicochemical properties

    • Reduction of liability issues (toxicity, off-target effects)

    • Optimization for penetration through the gram-negative cell envelope

  • Biological validation:

    • Confirmation of on-target activity using resistant mutants and overexpression studies

    • Assessment of spectrum of activity against clinical N. meningitidis isolates

    • Evaluation of resistance development frequency

    • In vivo efficacy in appropriate infection models

This approach requires typologically ordered tables to compare different manifestations of inhibitor types, highlighting similarities and differences in structural properties and their correlation with inhibitory potency .

What approaches can overcome challenges in crystallizing membrane-associated plsY for structural studies?

Crystallization of membrane-associated proteins like N. meningitidis plsY presents significant challenges that require specialized approaches:

  • Protein engineering strategies:

    • Truncation of flexible N- and C-terminal regions that may impede crystal packing

    • Fusion with crystallization chaperones like T4 lysozyme or BRIL inserted into loop regions

    • Surface entropy reduction through mutation of surface-exposed lysine and glutamate clusters to alanine

    • Thermostabilizing mutations identified through alanine scanning or computational prediction

  • Detergent and lipid optimization:

    • Systematic screening of detergent types and concentrations (maltoside series, glucoside series, neopentyl glycol derivatives)

    • Addition of specific lipids that stabilize native conformation (cholesterol, cardiolipin, phosphatidylglycerol)

    • Use of lipidic cubic phase or bicelle crystallization methods designed specifically for membrane proteins

    • Detergent exchange during purification to identify optimal solubilization conditions

  • Crystallization condition innovations:

    • Microseeding to promote crystal nucleation

    • Controlled dehydration to improve crystal order

    • Addition of inhibitors or substrate analogs to stabilize a single conformational state

    • Utilization of counter-ions that promote specific crystal contacts

  • Alternative structural approaches:

    • Single-particle cryo-electron microscopy (avoiding the need for crystals entirely)

    • Solid-state NMR spectroscopy for structural insights in a membrane-like environment

    • Hydrogen-deuterium exchange mass spectrometry to probe structural dynamics

Researchers should document their crystallization attempts using temporally ordered tables to track the evolution of crystallization conditions and outcomes, facilitating identification of promising optimization directions .

How can systems biology approaches integrate plsY function into broader N. meningitidis metabolic networks?

Integrating plsY function into the broader metabolic network of N. meningitidis requires sophisticated systems biology approaches that connect phospholipid biosynthesis with other cellular processes:

  • Multi-omics integration:

    • Transcriptomics: RNA-seq analysis to identify co-regulated genes and regulatory networks controlling plsY expression

    • Proteomics: Quantitative proteomics to measure enzyme abundance under different conditions

    • Metabolomics: Targeted and untargeted approaches to trace metabolic fluxes through phospholipid biosynthesis

    • Lipidomics: Comprehensive profiling of membrane composition changes

  • Genome-scale metabolic modeling:

    • Construction of constraint-based models incorporating plsY reactions

    • Flux balance analysis to predict the impact of plsY inhibition on cellular metabolism

    • Simulation of gene knockout phenotypes to predict synthetic lethal interactions

    • Integration of transcriptomic data to create context-specific models under different conditions

  • Protein-protein interaction network analysis:

    • Affinity purification-mass spectrometry to identify plsY interaction partners

    • Bacterial two-hybrid screening for binary interactions

    • Verification of interactions through co-immunoprecipitation or FRET analysis

    • Construction of functional interaction networks

  • Regulatory network mapping:

    • ChIP-seq to identify transcription factors binding to the plsY promoter

    • Promoter-reporter fusion assays to quantify expression under different conditions

    • Small RNA identification and characterization for post-transcriptional regulation

    • Characterization of feedback inhibition mechanisms

These approaches should be organized using cross-case comparative tables that facilitate systematic comparisons across different experimental conditions or genetic backgrounds, allowing researchers to trace the effects of plsY modulation throughout the metabolic network .

What emerging technologies will advance our understanding of plsY structure and function?

Several cutting-edge technologies show promise for transforming our understanding of N. meningitidis plsY:

  • Cryo-electron tomography: This technique allows visualization of plsY in its native membrane environment without crystallization, providing insights into its organization within the bacterial membrane and potential interactions with other membrane components. Combined with subtomogram averaging, it can achieve near-atomic resolution of membrane proteins in situ.

  • Integrative structural biology: Combining multiple experimental approaches (X-ray crystallography, NMR, cryo-EM, SAXS, cross-linking mass spectrometry) with computational modeling to generate comprehensive structural models that capture both static structure and dynamic behavior.

  • Time-resolved structural methods: Recent advances in X-ray free-electron lasers (XFELs) enable capturing transient structural states during catalysis, potentially revealing the conformational changes associated with substrate binding and product release in plsY.

  • Deep learning approaches: AlphaFold2 and similar artificial intelligence systems have revolutionized protein structure prediction. These methods can generate highly accurate models of plsY structure even in the absence of close structural homologs, and newer versions may soon predict protein-protein and protein-ligand interactions.

  • Single-molecule enzymology: Techniques like FRET-based single-molecule studies can reveal heterogeneity in enzyme behavior, conformational dynamics, and reaction pathways that are masked in ensemble measurements.

  • In-cell structural biology: Emerging methods for determining protein structures directly within living cells will provide unprecedented insights into how the native cellular environment affects plsY structure and function.

How might genetic variation in plsY impact N. meningitidis pathogenesis and antimicrobial resistance?

The relationship between plsY genetic variation and N. meningitidis pathogenesis/antimicrobial resistance requires investigation through multiple complementary approaches:

  • Comparative genomics across clinical isolates:

    • Whole-genome sequencing of diverse N. meningitidis strains with varying virulence and resistance profiles

    • Identification of plsY sequence variants and correlation with phenotypic characteristics

    • Analysis of selection pressures acting on plsY using dN/dS ratios and other evolutionary metrics

    • Investigation of horizontally transferred genes that might interact with plsY function

  • Functional characterization of natural variants:

    • Site-directed mutagenesis to introduce naturally occurring variations into laboratory strains

    • Recombinant expression and purification of variant enzymes for biochemical characterization

    • Growth and fitness measurements under different environmental conditions

    • Membrane composition analysis to identify changes in phospholipid profiles

  • Impact on antimicrobial susceptibility:

    • Minimum inhibitory concentration determination for various antibiotics against strains with different plsY variants

    • Investigation of membrane permeability changes associated with plsY variants

    • Synergistic or antagonistic interactions between plsY inhibitors and existing antimicrobials

    • Development of resistance models through experimental evolution

  • Virulence phenotype analysis:

    • Adhesion and invasion assays using human cell lines

    • Serum resistance testing

    • Biofilm formation capacity

    • In vivo infection models to assess colonization and disease progression

These investigations should employ co-occurrence tables to examine whether and how different features of cases (genetic variations, phenotypic outcomes) tend to co-occur, revealing patterns in their distribution . This approach will help establish whether specific plsY variants are associated with enhanced virulence or reduced antimicrobial susceptibility.

What interdisciplinary approaches could leverage plsY research for novel therapeutic strategies?

Interdisciplinary integration of plsY research offers promising avenues for innovative therapeutic strategies against N. meningitidis:

  • Nanotechnology-based delivery systems:

    • Development of lipid nanoparticles targeting bacterial membranes

    • Design of antimicrobial peptides that synergize with plsY inhibitors

    • Creation of photoactivatable inhibitors for spatiotemporal control of plsY inhibition

    • Bacterial membrane-specific delivery systems to overcome penetration barriers

  • Immunological approaches:

    • Identification of plsY-derived epitopes for vaccine development

    • Investigation of altered host immune responses to N. meningitidis strains with modified plsY activity

    • Design of immunomodulatory compounds that enhance host defense against N. meningitidis

    • Development of antibody-antibiotic conjugates targeting membrane components

  • Synthetic biology strategies:

    • Engineering of competing non-pathogenic bacteria expressing modified plsY variants

    • Design of CRISPR-Cas systems targeting plsY genes for specific bacterial elimination

    • Creation of synthetic phospholipid analogs that disrupt membrane integrity

    • Development of genetic circuits that sense N. meningitidis and trigger targeted responses

  • Computational drug discovery:

    • Quantum mechanical modeling of transition states for plsY catalysis

    • Machine learning approaches to predict activity and pharmacokinetic properties

    • Network pharmacology to identify multi-target strategies affecting phospholipid metabolism

    • Artificial intelligence-driven design of molecules with optimal properties

These interdisciplinary approaches should be organized using typologically ordered tables to compare different manifestations of therapeutic strategies, highlighting their similarities and differences in mechanism, potential efficacy, and developmental challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.