Recombinant Neisseria meningitidis serogroup C / serotype 2a Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Context

  • Gene Name: nqrE (synonyms: NMC0506) .

  • Complex Role: NqrE is a core subunit of the Na(+)-NQR complex, which comprises six subunits (A–F). This complex catalyzes:

    NADH+H++QuinoneNAD++Quinol+Na(out)+\text{NADH} + \text{H}^+ + \text{Quinone} \rightarrow \text{NAD}^+ + \text{Quinol} + \text{Na}^+_{\text{(out)}}

    The enzyme translocates 2–4 Na+^+ ions per NADH oxidized, depending on bacterial species .

  • Metabolic Importance: In N. meningitidis, Na(+)-NQR is a primary respiratory sodium pump, enabling adaptation to host niches with varying sodium concentrations .

3.1. Evolutionary Adaptation in Hyperinvasive Strains

Genomic studies of pandemic N. meningitidis serogroup A (clonal complex 5) revealed horizontal acquisition of nqrE alleles from hyperinvasive serogroup W (cc11) strains. These introgressed alleles enhanced metabolic efficiency, likely contributing to epidemic spread :

Introgression EventSource StrainFunctional Impact
nqrE (Area G)W:cc11 (1964)Increased NADH oxidation kinetics in low-sodium environments

This adaptation suggests Na(+)-NQR variants influence transmission fitness by optimizing energy metabolism under host-specific conditions .

3.2. Proteomic Regulation Under Stress

Proteomic profiling of N. meningitidis mutants lacking DNA-processing protein DprA showed downregulation of Na(+)-NQR subunits, including NqrE. This impaired respiratory chain activity and reduced resistance to oxidative stress, highlighting the enzyme’s role in bacterial survival during infection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrE; NMC0506; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
nqrE
Target Protein Sequence
MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVY SLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVNCA IFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGITEKMKYSDAPKGLKGLGITFI AAGLMAMAFMSFSGIQL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: nmc:NMC0506

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.