Recombinant Neisseria meningitidis serogroup C / serotype 2a NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock
Cat. No.
BT2044513
Source
in vitro E.coli expression system
Synonyms
nuoK; NMC0248; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Quick Inquiry

Description

Overview of NuoK

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the bacterial electron transport chain, specifically part of the NADH dehydrogenase I (NDH-1) complex. In Neisseria meningitidis, this complex facilitates electron transfer from NADH to ubiquinone, playing a critical role in cellular respiration and energy production . The recombinant version of nuoK is derived from N. meningitidis serogroup C/serotype 2a, a pathogen associated with invasive meningococcal disease (IMD) and outbreaks in immunocompromised populations .

Expression and Purification

  • Expressed in E. coli using standard recombinant protein production protocols.

  • Purified via affinity chromatography (His-tag) and confirmed by SDS-PAGE .

Role in Bacterial Metabolism

NuoK is essential for the NDH-1 complex, which:

  1. Transfers electrons from NADH to ubiquinone.

  2. Pumps protons across the membrane, contributing to ATP synthesis.

  3. Regulates redox balance under oxidative stress .

Genetic and Evolutionary Context

  • Recombination Activity: The nuoK gene is part of the meningococcal core genome, where ~40% of genes undergo homologous recombination. This genetic diversity may influence strain virulence and antibiotic resistance .

  • Serotype 2a Significance: Serotype 2a strains, including those with nuoK, have been linked to outbreaks due to immune evasion mechanisms (e.g., mutations in surface antigens like PorB) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; NMC0248; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
nuoK
Target Protein Sequence
MITLTHYLVLGALLFGISAMGIFMNRKNVLVLLMSIELMLLAVNFNFIAFSQHLGDTAGQ IFVFFVLTVAAAESAIGLAIMVLVYRNRQTINVADLDELKG
Uniprot No.
A1KRT3

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy within a proton gradient.
Database Links

KEGG: nmc:NMC0248

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.