Recombinant Neisseria meningitidis serogroup C / serotype 2a Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Lgt is expressed in Escherichia coli as a partial protein fragment (UniProt ID: A1KTV8) with the following key properties:

PropertyDetail
Product CodeCSB-EP375465NEX1-B
Source OrganismNeisseria meningitidis serogroup C/serotype 2a (strain FAM18)
Expression HostE. coli
Purity>85% (SDS-PAGE confirmed)
Storage-20°C/-80°C (lyophilized or liquid); avoid repeated freeze-thaw
ReconstitutionDeionized sterile water with 5–50% glycerol for stability

The enzyme retains functional motifs required for glycosyltransferase activity, though its recombinant form lacks the full-length sequence present in native strains .

Biological Function

Lgt is a β-1,4-galactosyltransferase critical for LOS biosynthesis:

  • Catalyzes the transfer of galactose to glucose linked to heptose (Hep) in the LOS α-chain, forming the Galβ1–4Glc–Hep structure .

  • Modulates bacterial adhesion and invasion via interactions with host glycans (e.g., asialoglycoprotein receptors) .

  • Genetic variability in lgt loci drives LOS structural diversity, influencing immune evasion and strain pathogenicity .

Research Applications

  • LOS Biosynthesis Studies: Used to elucidate galactose incorporation mechanisms in meningococcal LOS .

  • Vaccine Development: Serves as a target for immunogen design due to its role in surface epitope formation .

  • Enzyme Kinetics: High-yield recombinant expression enables biochemical characterization of substrate specificity (e.g., UDP-GlcNAc/UDP-GalNAc utilization) .

Comparative Analysis

Recombinant Lgt variants across Neisseria serogroups show conserved catalytic domains but divergent acceptor-binding regions:

FeatureSerogroup B Serogroup A Serogroup C
UniProt IDQ9JZF9Q9JUK4A1KTV8
Protein LengthFull-length (1–283 aa)Full-length (1–283 aa)Partial fragment
Key MutationVIAIR motif VIAIW motif Not reported

Challenges and Future Directions

  • Functional Redundancy: Overlapping activities with LgtB/LgtE complicate mechanistic studies .

  • Structural Resolution: Crystallographic data for serogroup C Lgt remains limited, hindering inhibitor design .

  • Clinical Relevance: Further work is needed to link lgt polymorphisms to strain-specific virulence in serogroup C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; NMC1036; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
lgt
Target Protein Sequence
MIIHPQFDPVLISIGPLAVRWYALSYILGFILFTFLGRRRIAQGLSVFTKESLDDFLTWG ILGVILGGRLGYVLFYKFSDYLAHPLDIFKVWEGGMSFHGGFLGVVIAIWLFGRKHGIGF LKLMDTVAPLVPLGLASGRIGNFINGELWGRVTDINAFWAMGFPQARYEDAEAAAHNPLW AEWLQQYGMLPRHPSQLYQFALEGICLFAVVWLFSKKQRPTGQVASLFLGGYGIFRFIAE FARQPDDYLGLLTLGLSMGQWLSVPMIVLGIVGFVRFGMKKQH
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.
Database Links

KEGG: nmc:NMC1036

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Prolipoprotein Diacylglyceryl Transferase (lgt) in Neisseria meningitidis?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. This enzyme is essential for bacterial survival, as deletion of the lgt gene is lethal to most Gram-negative bacteria, including Neisseria meningitidis . The enzyme transfers the diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. This lipid modification is crucial for proper anchoring of lipoproteins to the bacterial membrane, which in turn supports vital functions including maintenance of cell envelope architecture, nutrient uptake, and virulence .

How does Neisseria meningitidis serogroup C differ from other serogroups at the molecular level?

Neisseria meningitidis is classified into 13 distinct serogroups based on the structural differences in their capsular polysaccharides . Serogroup C, along with serogroups A, B, W135, and Y, is considered clinically important due to its association with invasive meningococcal disease . The serogroup C capsule is composed of α-(2→9)-linked sialic acid homopolymer, which differs structurally from other serogroups. For instance, serogroup A contains N-acetylmannosamine-1-phosphate, while serogroup B features α-(2→8)-linked sialic acid. These molecular differences in capsular composition affect the organism's interaction with the host immune system and contribute to pathogenicity profiles. Comparative genomic analyses of ST-7 serogroup A and C isolates have demonstrated that capsular switching occurs through genetic recombination at the capsular gene cluster locus .

What expression systems are most effective for producing recombinant Neisseria meningitidis lgt?

  • As an integral membrane protein, lgt contains multiple transmembrane domains that can cause toxicity to the host when overexpressed

  • Proper membrane insertion is critical for maintaining enzymatic activity

  • The protein may require specific lipid environments for optimal folding

The most effective approach involves using E. coli strains specifically designed for membrane protein expression (such as C41(DE3) or C43(DE3)), combined with vectors containing tightly regulated inducible promoters. Expression should be conducted at lower temperatures (16-25°C) after induction with reduced inducer concentrations to allow proper protein folding. The addition of specific phospholipids or detergents during cell lysis can help maintain protein stability during purification. For structural studies, fusion tags like maltose-binding protein or thioredoxin may improve solubility while preserving enzymatic activity.

What structural features of lgt are critical for its enzymatic function in Neisseria meningitidis?

Based on structural data from E. coli Lgt (which shares significant homology with N. meningitidis Lgt), several structural features are critical for enzymatic function:

  • Transmembrane helices: The enzyme contains multiple transmembrane domains that anchor it in the cytoplasmic membrane and create a binding pocket accessible from the membrane environment.

  • Conserved catalytic residues: Critical residues including Arg143 and Arg239 are essential for diacylglyceryl transfer activity . Complementation studies with lgt-knockout cells revealed that mutations in these residues completely abolish enzymatic function.

  • Binding sites: The crystal structure revealed two distinct binding sites within the enzyme - one for the phosphatidylglycerol substrate and another for the inhibitor/product .

  • Lateral access channels: The structural arrangement suggests that substrates enter and products exit laterally relative to the lipid bilayer, a feature that facilitates interaction with membrane-embedded components .

Mutagenesis studies targeting these conserved regions in N. meningitidis lgt would be expected to produce similar functional impairments, making them valuable targets for structure-function relationship investigations.

How do point mutations in the active site of lgt affect its catalytic efficiency?

Point mutations in the active site of lgt significantly impact its catalytic efficiency, with effects varying based on the specific residue altered. The most dramatic effects are observed when mutating the highly conserved arginine residues (Arg143 and Arg239), which completely abolish enzymatic activity . These residues are thought to participate in binding the phosphate group of the phosphatidylglycerol substrate and facilitating the nucleophilic attack by the cysteine residue of the prolipoprotein.

A methodological approach to studying these effects would include:

  • Site-directed mutagenesis to create a panel of point mutations in conserved residues

  • Expression and purification of the mutant proteins

  • In vitro enzymatic assays using synthetic substrates to measure kinetic parameters (Kₘ, kcat, kcat/Kₘ)

  • Structural analysis (X-ray crystallography or cryo-EM) to determine how mutations affect substrate binding

MutationRelative Activity (%)Impact on Substrate Binding (Kₘ)Impact on Catalytic Rate (kcat)
Wild type100ReferenceReference
R143K<5Significantly impairedModerately decreased
R143A<1Severely impairedSeverely decreased
R239K<10Moderately impairedSignificantly decreased
R239A<1Severely impairedSeverely decreased
H103A~30Minimally affectedModerately decreased

Note: This table represents hypothetical data based on similar enzymes and would need to be experimentally determined for N. meningitidis lgt.

What is the relationship between lgt and the capsular polysaccharide biosynthesis pathway in serogroup C?

While lgt and capsular polysaccharide biosynthesis operate in distinct pathways, they both contribute to the outer membrane architecture and pathogenicity of N. meningitidis. Lgt functions in lipoprotein processing, while capsular biosynthesis in serogroup C involves genes in the capsular gene cluster that synthesize α-(2→9)-linked sialic acid polymers .

The relationship between these pathways includes:

  • Membrane organization: Properly processed lipoproteins (via lgt pathway) help maintain membrane integrity, which provides the structural foundation for capsule attachment.

  • Virulence regulation: Both pathways contribute to immune evasion strategies through different mechanisms - lipoproteins often serve as immunomodulatory molecules while the capsule provides resistance to complement-mediated killing and phagocytosis.

  • Potential regulatory cross-talk: Though not directly demonstrated, it's possible that certain lipoproteins processed by lgt may function in regulating capsule expression or modification.

Researchers investigating this relationship should consider dual-pathway experimental approaches:

  • Gene knockout studies examining how lgt deficiency affects capsule expression

  • Proteomic analyses to identify lipoproteins involved in capsular polysaccharide regulation

  • Electron microscopy to visualize changes in capsule structure when lipoprotein processing is altered

What are the most reliable methods for assessing lgt enzymatic activity in vitro?

The most reliable methods for assessing lgt enzymatic activity in vitro combine radioisotope-based and fluorescence-based approaches:

  • Radiolabeled Phosphatidylglycerol Assay:

    • Substrate: [³H] or [¹⁴C]-labeled phosphatidylglycerol

    • Acceptor: Synthetic peptide containing the lipobox motif

    • Detection: Transfer of radiolabeled diacylglyceryl to the acceptor peptide, measured by liquid scintillation counting after separation by thin-layer chromatography

  • Fluorescence-Based Assay (based on GFP fusion systems):

    • A GFP-based in vitro assay can be used to correlate lgt activities with structural observations

    • This involves creating a fusion protein between the lipobox-containing peptide and GFP

    • Upon diacylglyceryl transfer, the modified fusion protein exhibits altered membrane association properties

    • Fluorescence microscopy or membrane fraction analysis can quantify the extent of modification

  • Mass Spectrometry-Based Approach:

    • Utilizes electrospray ionization mass spectrometry (ESI-MS) to directly observe mass shifts in the acceptor peptide following diacylglyceryl transfer

    • Particularly useful for detailed characterization of reaction products

    • Can be coupled with liquid chromatography for improved sensitivity and specificity

For optimal results, reaction conditions should be carefully controlled:

  • pH 7.4-8.0

  • Presence of divalent cations (Mg²⁺)

  • Appropriate detergents to maintain enzyme activity while solubilizing membrane components

  • Temperature 30-37°C

How can researchers effectively generate and characterize lgt knockout mutants in Neisseria meningitidis?

Generating lgt knockout mutants in N. meningitidis requires specialized approaches since direct deletion is typically lethal. A methodological workflow includes:

  • Conditional Knockout Strategy:

    • Create a complementation system with an inducible promoter controlling a second copy of lgt

    • Once the inducible copy is expressed, delete the native lgt gene using homologous recombination

    • Control expression levels using inducers like IPTG or tetracycline

  • Insertion Inactivation:

    • Insert antibiotic resistance cassettes into the lgt gene, similar to the approach used for lgtABE mutants

    • This disrupts gene function while maintaining selection pressure

    • Can be achieved using natural transformation if N. meningitidis is competent

  • CRISPR-Cas9 Approach:

    • Design guide RNAs targeting lgt sequence

    • Co-transform with a donor DNA containing the desired modification flanked by homology arms

    • Select for successful transformants

  • Characterization Methods:

    • PCR and sequencing verification of genetic modifications

    • LPS analysis using mild hydrazine treatment followed by ESI-MS to detect structural changes

    • Phenotypic assessment including growth rate, membrane integrity, and antibiotic sensitivity

    • Proteomics to identify unprocessed prolipoproteins that accumulate in the absence of functional lgt

    • Electron microscopy to visualize membrane structural changes

When working with conditional knockouts, it's essential to establish the minimum expression level required for viability and carefully titrate inducer concentrations for partial loss-of-function studies.

What are the optimal conditions for analyzing lipid-modified proteins in Neisseria meningitidis using mass spectrometry?

Analyzing lipid-modified proteins in N. meningitidis using mass spectrometry requires specialized sample preparation and instrument parameters:

  • Sample Preparation:

    • Mild hydrazine treatment (similar to the approach used in the lgtABE study) to obtain O-deacylated LPS samples that can be directly analyzed by ESI-MS

    • For more comprehensive analysis, combined O- and N-deacylation using aqueous KOH treatment followed by two-dimensional homo- and heteronuclear NMR methods

    • Lipid extraction using chloroform/methanol mixtures (typically 2:1 v/v)

    • Use of detergents like Triton X-114 for phase separation of lipoproteins

  • Mass Spectrometry Parameters:

    • Electrospray ionization in negative ion mode for LPS and lipid analysis

    • MALDI-TOF with appropriate matrices (2,5-dihydroxybenzoic acid) for intact lipoproteins

    • Liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) for peptide identification after enzymatic digestion

  • Data Analysis Considerations:

    • Modified search parameters to account for lipid modifications

    • Inclusion of variable modifications like diacylglyceryl attachment to cysteine

    • De novo sequencing approaches for novel modifications

    • Specialized software for glycolipid analysis

  • Technical Challenges and Solutions:

    • Ionization suppression from lipids: Use HILIC chromatography to separate glycolipids

    • Sample complexity: Consider subcellular fractionation prior to analysis

    • Low abundance of lipoproteins: Implement enrichment strategies such as Triton X-114 phase partitioning

The combination of these techniques provides a comprehensive approach to characterizing lipid-modified proteins and their structural changes in different genetic backgrounds.

How do post-translational modifications of lgt affect its function in different Neisseria meningitidis strains?

Post-translational modifications (PTMs) of lgt may vary between different N. meningitidis strains, potentially contributing to differences in enzymatic activity, substrate specificity, and virulence. While specific PTMs of N. meningitidis lgt have not been extensively characterized, research approaches to address this question include:

  • Comparative Proteomic Analysis:

    • Isolate lgt from various N. meningitidis strains (particularly comparing serogroup C with other serogroups)

    • Perform high-resolution mass spectrometry to identify and quantify PTMs

    • Compare PTM profiles between virulent and less virulent strains

  • Site-Directed Mutagenesis of PTM Sites:

    • Identify potential PTM sites through in silico prediction tools

    • Generate mutants where specific amino acids are replaced to prevent modification

    • Assess impact on enzymatic activity, membrane localization, and protein stability

  • Environmental Regulation of PTMs:

    • Examine how growth conditions (pH, temperature, nutrient availability) affect the PTM landscape

    • Determine if host-relevant conditions (e.g., iron limitation) trigger specific modifications

PTMs that might be relevant include phosphorylation of serine/threonine residues, which could affect enzyme activity; acetylation, which may influence protein-protein interactions; and lipidation, which would impact membrane association properties. The complex relationship between these modifications and enzyme function represents an underexplored area with significant implications for understanding strain-specific differences in pathogenicity.

What role does lgt play in immune evasion strategies of Neisseria meningitidis serogroup C?

Lgt plays an indirect but critical role in the immune evasion strategies of N. meningitidis serogroup C through its function in processing lipoproteins that interact with host immune systems:

  • Lipoprotein-Mediated Immune Modulation:

    • Lgt processes lipoproteins that can trigger or suppress TLR2-mediated immune responses

    • Properly modified lipoproteins may contribute to immune evasion by mimicking host structures

    • Some lipoproteins processed by lgt function in resistance to complement-mediated killing

  • Interaction with Host Innate Immunity:

    • Lipid modifications introduced by lgt affect how lipoproteins are recognized by pattern recognition receptors

    • This processing influences cytokine induction profiles during infection

    • The balance between pro-inflammatory and anti-inflammatory effects may determine disease progression

  • Experimental Approaches to Investigate This Relationship:

    • Comparative transcriptomics of host cells exposed to wild-type versus lgt-deficient bacteria

    • Cytokine profiling using both in vitro cell culture and in vivo animal models

    • Neutrophil activation assays measuring oxidative burst in response to purified lipoproteins

    • Complement deposition assays to assess the role of lgt-processed lipoproteins in complement evasion

  • Potential Role in Vaccine Development:

    • Understanding lgt-processed lipoproteins that contribute to immune evasion could identify new vaccine targets

    • Lipoproteins with conserved epitopes across strains may serve as broadly protective antigens

    • Modified lipoproteins could be developed as adjuvants for meningococcal vaccines

This research area highlights the complex interplay between bacterial protein processing and host immune recognition systems, with significant implications for understanding meningococcal pathogenesis.

How can structural data from E. coli lgt be extrapolated to develop inhibitors specific to Neisseria meningitidis lgt?

Developing inhibitors specific to N. meningitidis lgt based on E. coli structural data requires a systematic approach that accounts for both similarities and differences between these orthologs:

  • Comparative Structural Analysis:

    • The crystal structures of E. coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid (at 1.9 and 1.6 Å resolution, respectively) provide valuable templates

    • Perform homology modeling of N. meningitidis lgt based on E. coli structure

    • Identify conserved catalytic residues (like Arg143 and Arg239) that are essential for enzyme function across species

    • Map species-specific differences in binding pocket residues that could be exploited for selective inhibition

  • Structure-Based Drug Design Strategy:

    • Virtual screening of compound libraries against the modeled N. meningitidis lgt structure

    • Focus on compounds that interact with the two binding sites identified in the E. coli structure

    • Design competitive inhibitors that mimic the phosphatidylglycerol substrate

    • Consider mechanism-based inhibitors that form covalent bonds with catalytic residues

  • Selectivity Considerations:

    • Target unique structural features or sequence variations between human and bacterial proteins

    • Design inhibitors that exploit the lateral access mechanism observed in the E. coli enzyme

    • Focus on compounds that disrupt the specific conformational changes required for catalysis

  • Validation Approaches:

    • Enzymatic assays using purified N. meningitidis lgt to assess inhibitor potency (IC₅₀, Ki)

    • Cellular assays to evaluate membrane permeability and target engagement

    • Crystallization of N. meningitidis lgt with lead compounds to verify binding mode

    • In vitro selection for resistance to identify potential escape mutations

Binding Site FeatureE. coli LgtN. meningitidis LgtInhibitor Design Strategy
Catalytic pocketArg143, Arg239ConservedTarget these residues with charged/polar interactions
Substrate entry channelHydrophobicSlightly more polarDesign compounds with amphipathic properties
Membrane interfaceContains unique loopsMay have different topologyExploit species-specific differences

How might cryo-electron microscopy advance our understanding of lgt function in the membrane environment?

Cryo-electron microscopy (cryo-EM) offers transformative potential for understanding lgt function in its native membrane environment through several methodological advantages:

  • Native Structural Determination:

    • Unlike X-ray crystallography, which requires protein extraction and crystallization, cryo-EM can visualize lgt within nanodiscs or liposomes that mimic the native membrane

    • This approach preserves the critical lipid-protein interactions that may influence enzyme conformation and activity

    • Single-particle analysis can achieve near-atomic resolution (2-3Å) for membrane proteins of similar size to lgt

  • Conformational Dynamics Analysis:

    • Cryo-EM can capture different conformational states of lgt during the catalytic cycle

    • Time-resolved cryo-EM approaches could potentially visualize substrate binding, diacylglyceryl transfer, and product release

    • Classification algorithms can sort particles into discrete conformational ensembles

  • Context-Dependent Structural Studies:

    • Visualize lgt in complex with other membrane proteins involved in lipoprotein processing

    • Study structural changes under different lipid compositions that mimic N. meningitidis membrane

    • Examine how capsular polysaccharides might influence membrane protein organization

  • Technical Implementation Strategy:

    • Express and purify N. meningitidis lgt with minimal detergent exposure

    • Reconstitute into nanodiscs with defined lipid composition

    • Apply to cryo-EM grids using established techniques for membrane proteins (e.g., graphene oxide support)

    • Collect data on high-end microscopes with direct electron detectors

    • Process using contemporary software packages (RELION, cryoSPARC) with specialized protocols for membrane proteins

This approach would provide unprecedented insights into how lgt functions within its native environment and how this might differ between serogroups, potentially revealing new targets for therapeutic intervention.

What are the emerging technologies for studying lgt interactions with the bacterial membrane in real-time?

Several cutting-edge technologies are enabling real-time analysis of lgt interactions with bacterial membranes:

  • Super-Resolution Microscopy Approaches:

    • PALM/STORM imaging with fluorescently tagged lgt to track its distribution and dynamics in living bacteria

    • Single-molecule tracking to measure diffusion coefficients and confined movement within membrane domains

    • Protocol development would involve creating functional fluorescent protein fusions that preserve enzymatic activity

  • Förster Resonance Energy Transfer (FRET)-Based Biosensors:

    • Design of FRET pairs to monitor lgt conformational changes during substrate binding and catalysis

    • Real-time visualization of enzyme activity in living cells

    • This approach requires careful placement of fluorophores to avoid interference with enzyme function

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Measures solvent accessibility changes in different functional states

    • Can identify regions of lgt that interact with membrane or undergo conformational changes

    • Time-resolved experiments capture dynamic processes during catalysis

    • Implementation requires specialized sample handling under deuterated conditions

  • Nanopore-Based Single-Molecule Analysis:

    • Electrical detection of single enzyme molecules and their substrate interactions

    • Can provide kinetic information on individual catalytic events

    • Requires engineering of the protein for compatibility with nanopore systems

  • Native Mass Spectrometry of Membrane Complexes:

    • Direct observation of intact membrane protein-lipid complexes

    • Captures transient interactions with other membrane components

    • Technical challenges include maintaining native membrane environment during ionization

These technologies provide complementary information on different aspects of lgt function, from structural dynamics to in vivo activity patterns, and will be instrumental in developing a comprehensive understanding of this essential enzyme.

What are the implications of lgt research for developing novel antimicrobial strategies against Neisseria meningitidis?

Research on N. meningitidis lgt has significant implications for antimicrobial development through several translational pathways:

  • Direct Enzyme Inhibition Strategies:

    • Development of small molecule inhibitors targeting the active site of lgt

    • This approach is supported by structural data showing two distinct binding sites that could be exploited

    • Compounds that competitively inhibit phosphatidylglycerol binding or covalently modify catalytic residues would prevent lipoprotein processing

    • The essentiality of lgt in Gram-negative bacteria makes it an attractive target with potentially broad-spectrum activity

  • Lipoprotein Processing Pathway Intervention:

    • Target multiple enzymes in the lipoprotein processing pathway to achieve synergistic effects

    • Develop combination therapies targeting both lgt and other enzymes involved in lipoprotein maturation

    • This multi-target approach could reduce the likelihood of resistance development

  • Strain-Specific Considerations:

    • Exploit subtle differences in lgt structure between serogroups to develop tailored therapeutics

    • Design narrow-spectrum agents that selectively target pathogenic Neisseria while sparing commensal bacteria

    • This precision medicine approach could reduce disruption to the microbiome during treatment

  • Vaccine Development Applications:

    • Utilize knowledge of lgt-processed surface lipoproteins to identify novel vaccine antigens

    • Design modified lipoproteins as adjuvants that enhance immune responses to meningococcal antigens

    • Exploit lgt processing mechanisms to develop protein-based vaccines with improved stability and immunogenicity

  • Diagnostic Applications:

    • Develop assays detecting specific lipoproteins processed by lgt as biomarkers of infection

    • Create rapid diagnostics distinguishing between serogroups based on lipoprotein profiles

    • This could enable faster, more precise therapeutic interventions in clinical settings

These translational directions highlight how fundamental research on bacterial enzyme systems can lead to diverse applications addressing the ongoing challenges of antimicrobial resistance and infectious disease management.

How can heterologous expression systems be optimized for large-scale structural studies of Neisseria meningitidis lgt?

Optimizing heterologous expression systems for large-scale structural studies of N. meningitidis lgt requires addressing several technical challenges:

  • E. coli-Based Expression System Optimization:

    • Select specialized strains designed for membrane protein expression (C41/C43(DE3), Lemo21(DE3))

    • Engineer fusion constructs with solubility-enhancing partners (MBP, SUMO, or Mistic)

    • Implement codon optimization for N. meningitidis-specific codons

    • Fine-tune expression conditions:

      • Reduced temperature (16-20°C)

      • Lower inducer concentrations

      • Extended expression periods (24-48 hours)

      • Supplementation with specific phospholipids

  • Alternative Expression Hosts:

    • Explore cell-free expression systems coupled with nanodisc reconstitution

    • Consider Pichia pastoris for eukaryotic processing machinery

    • Evaluate specialized hosts like Brevibacillus for toxic membrane proteins

  • Purification Strategy Optimization:

    • Implement gentle solubilization using detergents screened for optimal activity retention:

      • DDM (n-Dodecyl-β-D-maltopyranoside)

      • LMNG (Lauryl maltose neopentyl glycol)

      • GDN (Glyco-diosgenin)

    • Employ affinity purification followed by size exclusion chromatography in detergent micelles

    • Consider lipid nanodiscs for maintaining native-like environment

  • Crystallization Approaches:

    • Lipidic cubic phase crystallization for membrane proteins

    • Surface engineering to remove flexible regions while preserving function

    • Antibody fragment co-crystallization to stabilize specific conformations

  • Quality Control Metrics:

    • Develop functional assays to verify activity post-purification

    • Implement thermal stability assays to monitor protein folding

    • Use circular dichroism to assess secondary structure integrity

Expression SystemAdvantagesLimitationsOptimization Strategy
E. coli C41/C43High yield, established protocolsMay not capture all PTMsLow temperature, reduced induction
Cell-free systemsAvoid toxicity issuesLower yield, higher costSupplement with specific lipids
Pichia pastorisBetter folding of complex proteinsSlower growth, glycosylation differencesCareful codon optimization
Native expressionAuthentic processingChallenging genetics, low yieldFocus on improved extraction methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.