Recombinant Neisseria meningitidis serogroup C / serotype 2a Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to CrcB in Neisseria meningitidis

Neisseria meningitidis serogroup C is a Gram-negative bacterium responsible for invasive meningococcal diseases such as meningitis and septicemia . Its genome encodes approximately 2,100–2,500 proteins, including virulence factors and metabolic regulators . CrcB, annotated as a putative fluoride ion transporter, is part of the bacterium’s survival machinery, though its exact role in pathogenesis remains understudied .

Putative Fluoride Ion Transport

CrcB is annotated as a fluoride efflux transporter, a function conserved across bacterial species to mitigate cytoplasmic fluoride toxicity . While direct evidence in N. meningitidis is limited, homologous proteins in E. coli and Pseudomonas aeruginosa regulate fluoride homeostasis via ion channels .

Mechanistic Studies

  • Fluoride Resistance: Used to investigate fluoride efflux mechanisms in pathogenic bacteria .

  • Protein-Protein Interactions: His-tagged CrcB facilitates pull-down assays to identify binding partners .

Vaccine Development

While CrcB is not currently a vaccine target, other meningococcal proteins (e.g., NadA, fHbp) have been incorporated into vaccines like 4CMenB . CrcB’s surface accessibility and conservation could warrant exploration as a candidate.

Experimental Considerations

  • Reconstitution: Requires dissolution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Limitations: Not for human use; repeated freeze-thaw cycles degrade activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; NMC1029; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
crcB
Target Protein Sequence
MLSNIIPLSIGAALGATARWLLNLAVPAAMSPATGNLFANWTGALLIGIFAETINHPQWK LLLITGFLGSLTTLSGFSLETVTLLQSNRPASALANIFLHTAGSLLLTWLGLKIGAAVK
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links

KEGG: nmc:NMC1029

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of serotype 2a in Neisseria meningitidis serogroup C strains?

Serotype 2a is a significant classification of Neisseria meningitidis serogroup C strains based on the PorB outer membrane protein. The serotype is determined by variable regions within the PorB proteins, particularly the surface-exposed loop VI (VR3 region). Serotype 2a organisms have been particularly prevalent in serogroup C meningococcal disease in Canada, showing an increase in the 1990s and becoming more prevalent than serogroup B organisms by 2000-2001 . The serotype classification is important for epidemiological tracking and understanding strain evolution.

Experimental data has shown that serotype 2a strains can undergo point mutations in the porB gene, particularly in the VR3 region, which may be a result of immune selection pressure. A documented outbreak strain showed a single nucleotide substitution (G to A) at position 700 in loop VI, changing the encoded amino acid from a negatively charged glutamic acid to a positively charged lysine .

How do researchers distinguish between different serotype variants of N. meningitidis?

Researchers employ multiple complementary techniques to distinguish between serotype variants:

  • PCR and DNA sequencing: Primers targeting the porB gene are used to amplify variable regions (VR1, VR2, VR3, and VR4). Sequencing of PCR products allows precise identification of nucleotide changes .

  • Western blot analysis: This technique can identify the expression of specific proteins and identify potential cleavage products, as demonstrated in studies of NHBA expression in different N. meningitidis strains .

  • Serological typing: Using specific antibodies against PorB or other outer membrane proteins to identify serotype-specific epitopes.

  • Whole genome sequencing: For comprehensive genetic characterization and identification of novel variants.

For serotype 2a strains specifically, researchers should focus on the porB gene sequence, particularly the VR3 region which corresponds to loop VI of the PorB protein, as this is where defining mutations have been documented .

What role does NHBA (Neisserial Heparin Binding Antigen) play in bacterial pathogenesis and how can this be experimentally determined?

NHBA (formerly known as GNA2132) is a surface-exposed lipoprotein universally expressed by N. meningitidis strains that contributes significantly to pathogenesis through:

  • Bacterial adhesion: NHBA facilitates adherence to human epithelial cells. This has been experimentally proven through adhesion assays comparing wild-type strains to nhba knockout mutants. Experiments showed that deletion of nhba reduced bacterial adhesion to Hec-1B human epithelial cells by 30-52% across different strains .

  • Serum resistance: NHBA binds heparin through an Arginine-rich region, which correlates with increased survival of unencapsulated bacteria in human serum. This provides a mechanism for immune evasion .

Methodological approaches to study NHBA function include:

  • Genetic knockout studies: Creation of nhba knockout strains and complemented strains to demonstrate loss and recovery of function .

  • Adhesion assays: Quantifying bacterial adherence to epithelial cell lines like Hec-1B and polarized Calu-3 cells .

  • Antibody inhibition assays: Pre-incubation of bacteria with anti-NHBA antibodies significantly reduces bacterial adhesion, confirming NHBA's role in this process .

  • Heparin binding assays: To confirm the interaction between NHBA and heparin and identify the specific binding regions .

  • Serum survival assays: To assess how NHBA contributes to bacterial persistence in human serum .

How does the immune system respond to PorB proteins, and what evidence suggests immune selection drives their evolution?

PorB proteins are important immunogenic outer membrane proteins that elicit bactericidal antibodies. Evidence supporting immune-driven evolution includes:

  • Phylogenetic evidence: Studies suggest that PorB protein is under strong immune selection pressure .

  • Antigenic variation: Point mutations in porB genes, particularly in regions encoding surface-exposed loops, suggest immune evasion. The documented G to A mutation at position 700 in the VR3 region of serotype 2a strains changes a negatively charged amino acid to a positively charged one, potentially altering antigenic properties .

  • Correlation with prevalence: As serotype 2a organisms became more prevalent in populations, the likelihood of population immunity increased, potentially driving the selection of variant strains that could escape recognition .

  • Bactericidal activity: Antibodies to PorB proteins have been demonstrated to be bactericidal, suggesting they are targets of protective immunity .

Researchers hypothesize that N. meningitidis serotype 2a strains alter their PorB outer membrane proteins to evade host defense mechanisms and escape natural immunity, thereby maintaining their ability to cause disease even in populations with prior exposure .

What are the most effective approaches for evaluating bactericidal antibody responses against N. meningitidis antigens?

Effective evaluation of bactericidal antibody responses requires rigorous methodology:

  • Serum Bactericidal Assay (SBA): The gold standard technique using human complement and immune sera. This approach was demonstrated in studies evaluating GNA2132/NHBA, showing that:

    • Strains lacking the target antigen showed negative titers with both pre-immune and immune sera

    • Strains expressing the target antigen were killed by immune sera with titers ranging from 16 to 64

  • Controls that must be included:

    • Pre-immune sera (negative control)

    • Positive control sera with known bactericidal activity

    • Isogenic knockout strains lacking the target antigen

    • Complemented strains where the antigen is reintroduced

  • Experimental design considerations:

    • Using human complement rather than rabbit complement for greater clinical relevance

    • Testing multiple serum dilutions (typically 2-fold serial dilutions)

    • Including appropriate controls to ensure genetic manipulations haven't affected complement sensitivity

    • Testing multiple clinical isolates to assess cross-protection

Sample TypeExpected Result with Target AntigenExpected Result without Target Antigen
Pre-immune seraNo killing (negative titers)No killing (negative titers)
Immune seraKilling (positive titers, e.g., 16-64)No killing (negative titers)

These approaches allow researchers to definitively establish whether specific antigens can induce protective bactericidal antibodies .

How should adhesion assays be designed to quantify the contribution of specific proteins to N. meningitidis epithelial cell adherence?

Adhesion assays require careful design and controls:

  • Cell line selection:

    • Hec-1B human epithelial cells for standard adherence assays

    • Polarized Calu-3 epithelial cells for assessing adherence to polarized respiratory epithelium

  • Bacterial strain preparation:

    • Wild-type strain

    • Isogenic knockout mutant (e.g., Δnhba)

    • Complemented mutant strain (to verify that phenotype restoration occurs)

  • Quantification methods:

    • Colony-forming unit (CFU) counting after detachment of adherent bacteria

    • Results reported as percentage relative to wild-type (set as 100%)

  • Antibody inhibition studies:

    • Pre-incubation of bacteria with increasing concentrations of specific antibodies

    • Use of pre-immune serum as control

    • Dose-response analysis to demonstrate specificity

  • Statistical analysis:

    • Experiments performed in triplicate

    • Multiple biological replicates (typically n=3)

    • Statistical tests such as ANOVA with appropriate post-hoc tests (e.g., Tukey's multiple comparison)

The experimental design should allow calculation of:

  • Fold difference in adhesion between wild-type and mutant strains

  • Percentage inhibition of adhesion by specific antibodies

  • Statistical significance of observed differences

What approaches are most effective for detecting and characterizing mutations in the porB gene of N. meningitidis?

Effective characterization of porB mutations requires a systematic approach:

  • PCR amplification: Using primers targeting the porB gene, with particular focus on variable regions VR1-VR4 .

  • Purification of PCR products: Using commercial kits (e.g., QIAquick PCR purification kit) to ensure high-quality template for sequencing .

  • DNA sequencing: Employing methods such as Prism Dye Termination Cycle Sequencing on platforms like ABI 377 DNA sequencer .

  • Sequence analysis: Using specialized software (e.g., from DNASTAR) to compile and analyze sequence data .

  • Alignment and comparison: Identifying specific nucleotide substitutions by comparing sequences to reference strains. For serotype 2a variants, particular attention should be paid to position 700 in loop VI (VR3 region) .

  • Prediction of amino acid changes: Assessing whether mutations are synonymous or non-synonymous, and evaluating the potential impact of amino acid substitutions on protein charge, structure, and antigenicity .

  • Structural modeling: Mapping mutations onto predicted protein structures to determine if they affect surface-exposed regions that might interact with antibodies.

This systematic approach allowed researchers to identify the critical G to A substitution at position 700 in the porB gene of outbreak strains, resulting in a glutamic acid to lysine substitution that likely altered the antigenicity of the PorB protein .

How does homologous recombination contribute to genetic diversity in N. meningitidis, and what experimental systems can model this process?

Homologous recombination is a key mechanism for generating genetic diversity in N. meningitidis. Research findings indicate:

  • Minimum homology requirements: In vivo studies suggest:

    • Recombination is undetectable with <20 bp of homology

    • A steep exponential increase occurs between 20-75 bp of homology

    • A slow linear increase is observed with >75 bp of homology

  • Mismatch tolerance: RecA, a key protein in homologous recombination, demonstrates remarkable tolerance for mismatches:

    • RecA can form recombination products in vitro even when 16% of bases are mismatched

    • Initial homology testing involves checking 8 bp sequences, tolerating one mismatch

    • Subsequent testing involves triplet-by-triplet examination

  • Structural basis: The crystal structure of heteroduplex products shows:

    • Organization into nearly B-form base pair triplets

    • Triplets separated by large rises

    • Stabilization by protein residues that intercalate in the rises

Experimental systems to model this process include:

  • In vitro RecA-mediated strand exchange assays

  • Systems using exogenous sequences with controlled lengths of homology

  • Mathematical models simulating homology testing with varying stringency levels

These models show that with perfect matching (0% mismatch tolerance), a 14 bp test region provides ~99% stringency, but stringency decreases with increasing mismatch tolerance .

How do post-translational modifications and proteolytic processing regulate NHBA function in N. meningitidis?

NHBA undergoes complex post-translational regulation through proteolytic processing by both bacterial and host proteases:

  • NalP protease processing:

    • The meningococcal NalP protease cleaves NHBA upstream from the Arginine-rich heparin-binding region

    • This is visible in Western blot analysis where the full-length NHBA protein and the N2 fragment generated by NalP cleavage can be observed in strain MC58

  • Human lactoferrin processing:

    • Human lactoferrin, a host protease, cleaves NHBA downstream from the Arginine-rich region

    • This represents a host defense mechanism potentially targeting a key bacterial virulence factor

  • Functional consequences:

    • Proteolytic processing may regulate the heparin-binding capacity of NHBA

    • Cleavage may release biologically active fragments with distinct functions

    • Processing potentially modulates bacterial adherence to host cells and serum resistance

  • Experimental approaches to study processing:

    • Western blot analysis to detect different NHBA fragments

    • Mutation of cleavage sites to generate processing-resistant variants

    • Functional assays comparing intact and processed forms

    • In vitro digestion with purified proteases

These regulatory mechanisms highlight the complex interplay between bacterial virulence factors and host defense systems, offering potential targets for therapeutic intervention .

What is the relationship between heparin binding and serum resistance in N. meningitidis, and how might this inform vaccine development?

The relationship between heparin binding and serum resistance represents a key aspect of N. meningitidis pathogenesis:

  • Mechanism of action:

    • NHBA binds heparin through an Arginine-rich region

    • This binding correlates with increased survival of unencapsulated bacteria in human serum

    • Suggests that heparin binding may protect against complement-mediated killing

  • Evidence for protective immunity:

    • NHBA induces bactericidal antibodies in animal models

    • It is recognized by sera from patients recovering from meningococcal disease

    • Anti-NHBA antibodies can provide protection in humans based on opsonophagocytic immunity

  • Vaccine implications:

    • NHBA is included in the recombinant MenB vaccine

    • Antibodies targeting the heparin-binding region may neutralize this virulence mechanism

    • The protein appears to be expressed during in vivo infection, making it a relevant target

    • Human sera from vaccinated individuals can kill strains expressing NHBA but not isogenic knockout strains

  • Future research directions:

    • Determining the precise mechanism by which heparin binding contributes to serum resistance

    • Identifying the optimal epitopes to target with vaccine-induced antibodies

    • Understanding how sequence variation in the heparin-binding region affects protection

    • Developing in vitro correlates of protection for vaccine evaluation

These findings position NHBA as an important protective antigen with a defined virulence function, supporting its inclusion in meningococcal vaccines .

What are the primary challenges in developing broadly protective vaccines against diverse N. meningitidis strains?

Developing broadly protective vaccines faces several research challenges:

  • Antigenic variability:

    • Point mutations in surface proteins like PorB can alter antigenicity

    • A single amino acid change (e.g., glutamic acid to lysine) can potentially enable immune evasion

    • Different strains express variants of antigens like NHBA with varying sequences

  • Protein expression differences:

    • Variable expression levels of target antigens across strains

    • Presence of proteases like NalP that can modify surface proteins

    • Potential masking of antigens by other surface structures

  • Immune response considerations:

    • Need for both bactericidal antibodies and opsonophagocytic immunity

    • Potential for cross-reactivity with human antigens

    • Requirement for memory responses for long-term protection

  • Experimental approaches to address these challenges:

    • Reverse vaccinology to identify conserved surface antigens

    • Bactericidal assays using diverse clinical isolates

    • Creation of isogenic knockout strains to confirm antigen-specific killing

    • Quantitative dot-blotting to assess recognition by convalescent sera

How can researchers design experiments to resolve contradictions in the literature regarding N. meningitidis virulence factors?

Resolving contradictions in the literature requires carefully designed experiments:

  • Standardized methodologies:

    • Consistent cell lines for adhesion assays (e.g., Hec-1B, polarized Calu-3)

    • Standardized bactericidal assays using human complement

    • Well-characterized reference strains alongside clinical isolates

  • Genetic approach:

    • Creation of isogenic knockout mutants in multiple strain backgrounds

    • Complementation studies to confirm phenotype restoration

    • Site-directed mutagenesis to assess the impact of specific amino acid changes

  • Direct comparison studies:

    • Side-by-side testing of contradictory findings using identical protocols

    • Multi-laboratory validation studies

    • Meta-analysis of published data with attention to methodological differences

  • Integrative approaches:

    • Combining in vitro, ex vivo, and in vivo models

    • Correlating genetic, structural, and functional data

    • Using systems biology approaches to understand complex interactions

  • Statistical considerations:

    • Adequate sample sizes and biological replicates

    • Appropriate statistical tests (e.g., ANOVA with Tukey's multiple comparison)

    • Reporting effect sizes alongside p-values

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.