Recombinant Neisseria meningitidis serogroup C / serotype 2a Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role

uppP is annotated as Undecaprenyl-diphosphatase (EC 3.6.1.27) and plays dual roles:

  • Metabolic Function: Converts UPP to UP, recycling lipid carriers for cell wall precursor synthesis.

  • Antibiotic Resistance: Known as the Bacitracin resistance protein, uppP enables bacteria to bypass bacitracin-induced UPP accumulation, which disrupts cell wall integrity .

Antimicrobial Target

uppP is a potential target for novel antibiotics. Inhibitors disrupting its activity could:

  • Block peptidoglycan recycling.

  • Sensitize bacteria to bacitracin and β-lactams .

Recombinant Production

  • Purification: Affinity chromatography using tags (e.g., His-tag) followed by buffer optimization.

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C retain function for ≤1 week .

Clinical and Industrial Relevance

  • Pathogenesis: Essential for N. meningitidis survival in host environments, particularly during nasopharyngeal colonization and bloodstream invasion .

  • Biotechnology: Used in enzymatic assays to study cell wall biosynthesis pathways .

Comparative Analysis

FeatureN. meningitidis uppPE. coli uppP
Catalytic EfficiencyHigh substrate specificityBroad substrate range
Antibiotic RoleBacitracin resistanceBacitracin sensitivity
Gene RegulationConstitutively expressedStress-induced

Unresolved Questions

  • How does uppP interact with other cell wall synthesis enzymes (e.g., MurG)?

  • Could structure-guided drug design yield selective inhibitors?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; NMC1759; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
uppP
Target Protein Sequence
MDFLIVLKALMMGLVEGFTEFLPISSTGHLIVFGNLIDFHSNHKVFEITIQLGAVLAVVF EYRQRFSNVLHGVGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFNPLSVAVMLVL GGFFILWVEKRQSRAEPKIVDVDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGI ERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHDVGLILIGFVAAFVSGLVAVKALLR FVSKKNYIPFAYYRIVFGIAIIILWLSGWISWE
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: nmc:NMC1759

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of uppP in Neisseria meningitidis?

Undecaprenyl-diphosphatase (uppP) plays a critical role in cell wall biosynthesis by catalyzing the dephosphorylation of undecaprenyl diphosphate (Und-PP) to generate undecaprenyl phosphate (Und-P). This reaction is essential as Und-P serves as a lipid carrier that transports cell wall precursors across the cytoplasmic membrane in bacteria . In N. meningitidis, this process is fundamental for maintaining cell wall integrity and bacterial survival. The enzyme belongs to a family of phosphatases that are conditionally essential, as demonstrated in analogous systems like Escherichia coli where multiple enzymes (BacA, PgpB, YbjG, and LpxT) can perform this dephosphorylation .

How does uppP expression relate to meningococcal virulence and adaptation?

During infection, N. meningitidis encounters numerous environmental changes that require rapid adaptation. Transcriptome analysis has shown that approximately 30% of the organism's genome undergoes expression changes during blood infection . While specific data on uppP regulation is limited in the provided literature, the enzyme's function in cell wall synthesis positions it as a critical factor in the bacterium's adaptation strategy. The peptidoglycan sacculus, which requires Und-P for its synthesis, is a stress-bearing structure essential for bacterial survival under various environmental conditions . Any disruption in uppP function could potentially compromise cell wall integrity and reduce bacterial fitness during infection.

What are the established methods for producing recombinant N. meningitidis uppP?

Production of recombinant uppP typically involves the following methodological approach:

  • Gene amplification from N. meningitidis serogroup C genomic DNA

  • Cloning into an expression vector with an appropriate tag (His-tag is commonly used)

  • Transformation into a compatible expression host (often E. coli strains optimized for membrane protein expression)

  • Expression under controlled conditions, typically using IPTG induction

  • Membrane fraction isolation followed by detergent solubilization

  • Purification via affinity chromatography and size exclusion chromatography

For membrane proteins like uppP, special considerations include the use of mild detergents for solubilization and maintaining appropriate buffer conditions to preserve enzymatic activity throughout the purification process.

What experimental design is optimal for assessing uppP enzyme kinetics?

Based on established approaches for enzyme kinetic analysis, an optimal experimental design for uppP would incorporate the following parameters:

ParameterRecommended RangeConsiderations
Sample number15 distinct measurementsBalances statistical power with experimental feasibility
Incubation timeUp to 40 minutesAllows capture of initial reaction rates
Starting substrate concentration (C₀)0.01-100 μMSpans expected Km range for accurate determination
Temperature37°CPhysiologically relevant for N. meningitidis
Buffer compositionpH 6.5-7.5Should mimic physiological conditions

For robust kinetic parameter determination, a penalized expectation of determinant (ED)-optimal design with discrete parameter distribution is recommended, as this approach minimizes uncertainty in Vmax and Km estimates . When analyzing data, non-linear regression methods should be employed to account for potential substrate inhibition effects commonly observed with lipid-processing enzymes.

How can researchers effectively study the role of uppP in N. meningitidis adaptation to human blood?

To investigate uppP's role in adaptation to human blood, researchers should consider a time-course transcriptome analysis similar to the approach described for N. meningitidis whole blood infection models . This methodology would include:

  • Cultivation of N. meningitidis in an ex vivo human whole blood model

  • Collection of samples at defined time points (e.g., 0, 30, 60, and 120 minutes)

  • RNA extraction and quality assessment

  • Transcriptome analysis using RNA-Seq or microarray approaches

  • Quantitative RT-PCR validation of expression changes

  • Construction of uppP mutant strains to assess survival in human blood

This approach allows for assessment of gene expression dynamics during blood adaptation. Previous studies have shown that N. meningitidis significantly alters expression of genes related to iron acquisition, transcriptional regulation, metabolism, and surface-exposed virulence factors during blood infection . Understanding uppP regulation in this context could provide insights into its role in meningococcal pathogenesis.

What methods can be employed to identify the substrate binding site of uppP?

Identifying the substrate binding site of uppP requires a multi-faceted approach:

  • Structural analysis: X-ray crystallography or cryo-electron microscopy of purified uppP, ideally in complex with substrate analogs or inhibitors.

  • Site-directed mutagenesis: Systematic mutation of conserved residues predicted to be involved in substrate binding, followed by kinetic characterization.

  • Molecular docking and simulation: In silico methods to predict interactions between uppP and Und-PP.

  • Photoaffinity labeling: Using modified substrate analogs that can be crosslinked to binding site residues upon UV activation.

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions with altered solvent accessibility upon substrate binding.

Recent studies on related undecaprenyl-processing enzymes have proposed specific carrier lipid-binding sites . Similar approaches could be applied to N. meningitidis uppP to elucidate its substrate binding mechanism.

How does genetic variation in uppP across different N. meningitidis strains impact enzyme function?

N. meningitidis undergoes extensive recombination, which significantly impacts its genome composition and virulence potential . Comparative genome analysis has revealed that approximately 40% of the meningococcal core genes are affected by recombination, particularly those involved in metabolism, DNA replication, and repair . While specific data on uppP variation is limited in the provided search results, several methodological approaches can be employed to assess the impact of genetic variation on enzyme function:

  • Sequence alignment of uppP from diverse N. meningitidis isolates to identify polymorphic sites

  • Recombinant expression and kinetic characterization of uppP variants

  • Complementation assays in uppP-deficient bacterial strains

  • Molecular dynamics simulations to predict the functional impact of amino acid substitutions

These approaches would help determine whether genetic variation in uppP contributes to differences in meningococcal fitness or virulence.

What is the relationship between uppP mutations and antibiotic resistance in N. meningitidis?

The relationship between uppP and antibiotic resistance stems from its role in cell wall biosynthesis, which is the target of several antibiotic classes. While specific data on uppP mutations and resistance is not explicitly mentioned in the provided search results, researchers can investigate this relationship through:

  • Screening clinical isolates with varying antibiotic susceptibilities for uppP sequence variations

  • Generation of laboratory strains with uppP mutations and assessment of their antibiotic susceptibility profiles

  • Biochemical characterization of uppP variants found in resistant strains

  • Structural analysis of uppP-antibiotic interactions

Understanding this relationship is particularly important as cell wall synthesis represents a major antimicrobial target, and alterations in enzymes like uppP could potentially contribute to resistance mechanisms.

What are the main technical challenges in working with recombinant N. meningitidis uppP?

Researchers face several technical challenges when working with recombinant uppP:

  • Membrane protein solubilization: As an integral membrane protein, uppP requires careful detergent selection for solubilization without compromising activity.

  • Substrate availability: The natural substrate, Und-PP, is not commercially available and must be synthesized or substituted with analogs for in vitro assays.

  • Assay development: Detecting phosphate release from Und-PP requires sensitive methods due to potential interference from detergents and buffer components.

  • Protein stability: Maintaining enzymatic activity during purification and storage can be challenging for membrane-associated phosphatases.

  • Expression yield: Obtaining sufficient quantities of properly folded recombinant protein often requires optimization of expression conditions.

To overcome these challenges, researchers should consider:

  • Screening multiple detergents and buffer conditions

  • Using fluorescent or radioactively labeled substrate analogs for increased sensitivity

  • Employing nanodiscs or liposomes to provide a native-like membrane environment

  • Optimizing expression systems specifically designed for membrane proteins

How can researchers distinguish between the effects of uppP and other phosphatases in N. meningitidis?

Distinguishing the specific role of uppP from other phosphatases with potentially overlapping functions requires a systematic approach:

  • Gene deletion studies: Construction of single and multiple phosphatase mutants to identify specific and redundant functions, similar to studies in E. coli that identified conditional essentiality of Und-PP phosphatases .

  • Biochemical specificity: In vitro characterization of substrate specificity using purified enzymes and various phosphorylated substrates.

  • Inhibitor studies: Utilizing specific inhibitors that target uppP but not other phosphatases.

  • Genetic complementation: Testing whether expression of other phosphatases can complement uppP deficiency.

  • Conditional expression systems: Employing regulatable promoters to control uppP expression and observe the immediate effects of its depletion.

These approaches would help delineate the specific contribution of uppP to undecaprenyl phosphate metabolism and distinguish it from the activities of other phosphatases in N. meningitidis.

What novel approaches might enhance our understanding of uppP's role in meningococcal virulence?

Several innovative approaches could advance our understanding of uppP's role in virulence:

  • Single-cell tracking of uppP activity: Development of fluorescent reporters that respond to changes in undecaprenyl phosphate levels or uppP activity.

  • Conditional depletion systems: CRISPR interference or degron-based approaches to rapidly modulate uppP levels during infection.

  • Chemical genetics: Screening for small molecules that specifically modulate uppP activity without affecting other phosphatases.

  • Interactome analysis: Identification of proteins that physically interact with uppP to understand its integration into broader cellular networks.

  • Systems biology approaches: Integration of transcriptomic, proteomic, and metabolomic data to position uppP within the context of global adaptation responses.

Such approaches would provide a more comprehensive understanding of how uppP contributes to meningococcal pathogenesis and could identify novel strategies for therapeutic intervention.

How might uppP be exploited as a target for novel antimicrobial development?

The essential nature of undecaprenyl phosphate in bacterial cell wall synthesis makes uppP an attractive target for antimicrobial development . Researchers interested in this direction should consider:

  • High-throughput screening: Development of assays suitable for screening compound libraries for uppP inhibitors.

  • Structure-based drug design: Utilizing structural information about uppP to design targeted inhibitors.

  • Natural product exploration: Investigating whether natural products target bacterial phosphatases involved in cell wall synthesis.

  • Combination approaches: Assessing synergy between uppP inhibitors and existing antibiotics.

  • Specificity assessment: Ensuring that potential inhibitors target bacterial uppP without affecting human phosphatases.

The vulnerability created by defects in Und-P metabolism has been demonstrated through genetic screens that identified synthetic lethal interactions , suggesting that uppP inhibitors could be particularly effective when combined with other agents that stress bacterial cell wall synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.