Recombinant Neisseria meningitidis serogroup C / serotype 2a UPF0756 membrane protein NMC1845 (NMC1845)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

The recombinant NMC1845 protein is produced using E. coli expression systems, which provide an efficient platform for generating sufficient quantities for research purposes. The expression process involves transforming E. coli cells with a plasmid containing the NMC1845 gene sequence fused to an N-terminal His tag coding sequence .

After expression, the protein undergoes purification processes, typically involving affinity chromatography that utilizes the His tag to selectively bind the protein to a nickel column. The final product is often provided as a lyophilized powder to ensure stability during shipping and storage .

Functional Aspects and Research Implications

While specific functional studies on NMC1845 appear limited in the available literature, insights can be gained by examining the characteristics of membrane proteins from Neisseria meningitidis in general. Outer membrane proteins in this pathogen often serve crucial functions in bacterial survival, host interaction, and pathogenesis.

Comparative Analysis with Other Neisseria Membrane Proteins

Understanding NMC1845 in the context of other Neisseria membrane proteins can provide valuable insights into its potential structure and function. Research on related proteins suggests that outer membrane proteins from this pathogen often have complex structures with distinct domains serving specialized functions.

Applications in Research and Diagnostics

Recombinant proteins like NMC1845 have multiple applications in scientific research and potentially in diagnostic or therapeutic development.

Current Research Applications

The available recombinant forms of NMC1845 can be utilized in:

  1. Structural biology studies to determine three-dimensional protein structure

  2. Functional assays to identify binding partners and biochemical activities

  3. Immunological studies to evaluate antibody responses

  4. Development of detection methods for Neisseria meningitidis serogroup C

The protein is available in forms suitable for ELISA applications, suggesting its use in immunological detection systems . Such applications might be particularly relevant in research settings focused on meningococcal pathogenesis or vaccine development.

Potential Relevance to Meningococcal Disease

Neisseria meningitidis is a significant human pathogen that can cause invasive meningococcal disease (IMD), including meningitis and septicemia. While typically a commensal bacterium of the nasopharynx, certain strains can cause severe infections .

Recent research has observed expanding clinical manifestations of Neisseria meningitidis, with evidence of urogenital infections typically associated with Neisseria gonorrhoeae, suggesting overlapping clinical syndromes between these related pathogens . This evolving understanding of Neisseria pathogenesis highlights the importance of studying membrane proteins like NMC1845 that may be involved in host-pathogen interactions across different anatomical sites.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
NMC1845; UPF0756 membrane protein NMC1845
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
NMC1845
Target Protein Sequence
MNFSFVPLFLVTLILLGVVSNNNSITISATILLLMQQTALVQFVPLVEKHGLNLGIILLT IGVLSPLVSGKAQVPPVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQPVLITGLLIGT VIGVAFMGGIPVGPLIAAGILSFVVGKG
Uniprot No.

Target Background

Database Links

KEGG: nmc:NMC1845

Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does NMC1845 compare structurally to other membrane proteins in Neisseria meningitidis?

When analyzing membrane proteins in Neisseria meningitidis, researchers should consider both sequence homology and structural features. While NMC1845 is a membrane protein with 148 amino acids, the more extensively studied PorA (Class 1 protein) functions as a cationic porin in the outer membrane . Comparative analysis would require:

  • Sequence alignment with other membrane proteins like PorA

  • Prediction of transmembrane domains using programs like TMHMM or Phobius

  • Analysis of conserved motifs across Neisseria membrane proteins

  • Comparison of structural features like beta-barrel arrangements typical of porins

Current structural data suggests that Neisseria outer membrane proteins often form beta-barrel structures that traverse the membrane, with surface-exposed loops that may serve as targets for the immune system. This is particularly relevant for proteins like PorA, which is effective in generating bactericidal immune responses following infection and has been investigated as a potential antigen for meningococcal vaccines . Researchers should consult databases like the Membrane Protein Data Bank (MPDB) for comparative structural information .

What experimental approaches are best suited to determine the membrane topology of NMC1845?

Determining the membrane topology of NMC1845 requires a multi-technique approach:

  • Computational prediction: Begin with algorithms like TMHMM, HMMTOP, or PredictProtein to identify potential transmembrane segments based on hydrophobicity profiles and other sequence features.

  • Site-directed mutagenesis with reporter fusion: Create fusion proteins with reporters like alkaline phosphatase (PhoA) or green fluorescent protein (GFP) at different positions. PhoA is only active when located in the periplasm, while GFP fluoresces only when in the cytoplasm.

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable sulfhydryl reagents.

  • Protease protection assays: Expose membrane vesicles to proteases; regions protected from digestion are likely embedded in the membrane.

  • Antibody accessibility: Generate antibodies against specific peptide regions and test their ability to bind intact cells versus permeabilized cells.

The combined results from these approaches provide a comprehensive map of which segments span the membrane and which regions face the cytoplasm, periplasm, or extracellular environment. When expressing recombinant NMC1845 for these studies, the IMPACT-TWIN system could be utilized as it has proven effective for the expression of similar membrane proteins like PorA .

What are the optimal conditions for expressing recombinant NMC1845 protein in E. coli?

Optimal expression of recombinant NMC1845 in E. coli requires careful optimization of multiple parameters:

Expression system selection:

  • Based on available data, E. coli has been successfully used as an expression host for the full-length NMC1845 protein (amino acids 1-148) .

  • For membrane proteins like NMC1845, E. coli strains specifically designed for membrane protein expression such as C41(DE3), C43(DE3), or Lemo21(DE3) often yield better results than standard strains.

Vector and fusion tag optimization:

  • The use of an N-terminal His-tag has been demonstrated for NMC1845 .

  • For difficult-to-express membrane proteins, fusion systems like the IMPACT-TWIN system (used successfully for related meningococcal membrane proteins) may be advantageous, allowing self-cleavage of the intein at its C-terminus under controlled conditions .

  • When using the IMPACT-TWIN system, addition of a minimal amino acid sequence (Gly-Arg-Ala) to the N-terminus of the mature protein may improve cleavage efficiency .

Expression conditions:

  • Temperature: Lower temperatures (16-25°C) often improve proper folding of membrane proteins

  • Induction: Low concentrations of inducer (0.1-0.5 mM IPTG) for extended periods (16-24 hours)

  • Media supplements: Addition of glycerol (0.5-1%) and specific detergents (0.05-0.2% β-D-thioglucopyranoside) can improve membrane protein yields

Monitoring expression:

  • Western blot analysis using anti-His antibodies

  • Small-scale expression tests to optimize conditions before scaling up

The specific E. coli expression system used for NMC1845 has yielded properly folded protein suitable for downstream applications, though detailed optimization parameters have not been fully described in the available literature .

What purification strategies yield the highest purity and activity for NMC1845?

Purification of membrane proteins like NMC1845 presents unique challenges requiring specialized approaches:

Initial extraction from membranes:

  • Cell lysis followed by membrane fraction isolation via ultracentrifugation

  • Membrane solubilization using appropriate detergents:

    • For similar membrane proteins, detergents like n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin have shown efficacy

    • Detergent screening is recommended to identify optimal solubilization conditions

Affinity chromatography:

  • His-tagged NMC1845 can be purified using immobilized metal affinity chromatography (IMAC)

  • Batch binding or column formats with Ni-NTA or TALON resins

  • Careful optimization of imidazole concentrations for washing and elution steps

Alternative purification approach:

  • The IMPACT-TWIN system, successfully used for related meningococcal membrane proteins, offers an alternative strategy:

    • The fusion protein binds to a chitin bead column via the chitin-binding domain

    • Self-cleavage of the intein is induced (optimal at pH 7.0 after 5 days at 4°C for similar proteins)

    • Release of mature protein without the need for proteases or harsh conditions

Polishing steps:

  • Size exclusion chromatography to remove aggregates and ensure monodispersity

  • Ion exchange chromatography may further enhance purity

Quality control:

  • SDS-PAGE and Western blotting to assess purity (>90% purity has been achieved for similar recombinant membrane proteins)

  • Mass spectrometry to confirm protein identity

For recombinant NMC1845, lyophilization has been used for final storage, with reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

How can researchers overcome aggregation issues during recombinant NMC1845 purification?

Membrane protein aggregation is a common challenge in purification workflows. For NMC1845, several strategies can minimize aggregation:

Detergent optimization:

  • Perform detergent screening to identify optimal types and concentrations

  • Consider mild detergents like DDM, LMNG, or GDN that maintain membrane protein stability

  • Test detergent mixtures, which sometimes outperform single detergents

Buffer optimization:

  • Include glycerol (5-10%) to enhance protein stability

  • Test different pH ranges (typically pH 7.0-8.0 works well for membrane proteins)

  • Add stabilizing agents such as cholesteryl hemisuccinate (CHS) or specific lipids

Temperature control:

  • Maintain samples at 4°C during purification

  • Avoid freeze-thaw cycles, as indicated in storage guidelines for NMC1845

Concentration techniques:

  • Use gentle concentration methods (centrifugal devices with larger molecular weight cutoffs)

  • Concentrate gradually with intermittent mixing

  • Add specific lipids or amphipols during concentration

Analytical approaches to monitor aggregation:

  • Dynamic light scattering (DLS) to assess sample homogeneity

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Negative-stain electron microscopy to visually inspect protein dispersity

For long-term storage, NMC1845 has been successfully maintained as a lyophilized powder, with recommendations to reconstitute in deionized sterile water and add 5-50% glycerol before aliquoting for storage at -20°C/-80°C . The addition of specific stabilizing agents during reconstitution may further reduce aggregation propensity during storage and subsequent experimental use.

What biophysical techniques are most effective for characterizing the structure of NMC1845?

Characterizing the structure of membrane proteins like NMC1845 requires specialized approaches:

X-ray crystallography:

  • Has been successfully applied to related membrane proteins from Neisseria meningitidis

  • Requires highly pure, homogeneous, and stable protein preparations

  • Often necessitates crystallization in lipidic cubic phases or bicelles

  • Crystallization conditions must be extensively screened, typically including various detergents, lipids, and precipitants

Cryo-electron microscopy (cryo-EM):

  • Increasingly powerful for membrane protein structure determination

  • Avoids crystallization challenges

  • May require formation of protein-scaffold complexes (e.g., nanodiscs, amphipols) to increase particle size

  • Single-particle analysis or tomography approaches depending on protein size

Nuclear Magnetic Resonance (NMR) spectroscopy:

  • Solution NMR: Limited applicability for membrane proteins >30 kDa

  • Solid-state NMR: Provides information on protein dynamics and ligand interactions

  • Requires isotopic labeling (15N, 13C, 2H) during recombinant expression

Complementary structural techniques:

  • Circular dichroism (CD) spectroscopy for secondary structure content

  • Fourier-transform infrared spectroscopy (FTIR) for membrane protein orientation

  • Small-angle X-ray scattering (SAXS) for molecular envelope determination

According to the Membrane Protein Data Bank (MPDB), structures of membrane proteins are derived from various methods including X-ray diffraction, electron diffraction, NMR, and cryo-EM . For NMC1845 specifically, researchers should consider consulting the MPDB for related membrane protein structures that could serve as templates for homology modeling if experimental structure determination proves challenging.

How can researchers assess the functional activity of purified NMC1845?

Assessing the functional activity of purified NMC1845 requires consideration of its potential roles as a membrane protein in Neisseria meningitidis. Based on knowledge of related proteins like PorA, which functions as a cationic porin , several approaches can be employed:

Liposome reconstitution assays:

  • Reconstitute purified NMC1845 into liposomes

  • Measure permeability to ions or small molecules using:

    • Fluorescent dye release/uptake assays

    • Electrode-based ion flux measurements

    • Radioactive tracer flux studies

Electrophysiological characterization:

  • Black lipid membrane (BLM) electrophysiology

  • Patch-clamp studies of proteoliposomes

  • Analysis of channel properties (conductance, ion selectivity, voltage-dependence)

Binding studies:

  • Surface plasmon resonance (SPR) to detect interactions with potential ligands

  • Isothermal titration calorimetry (ITC) for binding thermodynamics

  • Microscale thermophoresis (MST) for measuring binding affinities

Functional complementation:

  • Express NMC1845 in Neisseria strains lacking the endogenous protein

  • Assess restoration of relevant phenotypes

  • Compare growth characteristics under various stress conditions

Immunological activity assessment:
Given that related meningococcal membrane proteins elicit bactericidal immune responses , researchers might also evaluate:

  • Antibody recognition of native versus recombinant protein

  • Bactericidal activity of antibodies raised against recombinant NMC1845

  • Epitope mapping to identify immunologically relevant regions

For each functional assay, appropriate controls should be included, such as empty liposomes, denatured protein, or well-characterized related membrane proteins with known functional properties.

What computational approaches can predict NMC1845 structure-function relationships?

Computational methods offer valuable insights into NMC1845 structure-function relationships, especially when experimental data is limited:

Sequence-based predictions:

  • Transmembrane topology prediction using algorithms like TMHMM, HMMTOP, or MEMSAT

  • Identification of conserved functional motifs through multiple sequence alignment

  • Evolutionary coupling analysis to identify co-evolving residues likely to be in spatial proximity

Homology modeling:

  • Identify structural templates using tools like HHpred or SWISS-MODEL

  • Generate homology models based on related membrane proteins

  • Validate models through energy minimization and Ramachandran plot analysis

  • Consider the Membrane Protein Data Bank (MPDB) as a resource for potential structural templates

Molecular dynamics simulations:

  • Embed modeled protein in a lipid bilayer matching Neisseria membrane composition

  • Perform extended (>100 ns) all-atom simulations to assess structural stability

  • Analyze protein-lipid interactions and conformational dynamics

  • Simulate ion or substrate permeation if NMC1845 functions as a channel or transporter

Protein-protein interaction prediction:

  • Identify potential interaction partners using co-expression data or bacterial two-hybrid screens

  • Model complex formation with predicted partners

  • Simulate dynamic behavior of protein complexes in membrane environments

Functional site prediction:

  • Identify potential binding pockets using programs like CASTp or FTMap

  • Predict functional residues based on evolutionary conservation patterns

  • Virtual screening of potential ligands if binding sites are identified

These computational approaches should inform experimental design, allowing researchers to generate testable hypotheses about NMC1845 function and guide site-directed mutagenesis studies to validate predictions. Integration of computational and experimental data will provide the most comprehensive understanding of this membrane protein's biological role.

What is the potential of NMC1845 as a vaccine antigen against Neisseria meningitidis?

The potential of NMC1845 as a vaccine antigen against Neisseria meningitidis should be evaluated in the context of what is known about other meningococcal membrane proteins:

Immunological properties:
Studies on related meningococcal membrane proteins like PorA (Class 1 protein) have demonstrated that outer membrane proteins can be particularly effective in generating bactericidal immune responses following infection . This suggests that membrane proteins represent promising vaccine antigen candidates. Assessment of NMC1845's vaccine potential would require:

  • Characterization of surface exposure and accessibility to antibodies

  • Evaluation of sequence conservation across meningococcal strains

  • Determination of immunogenicity in animal models

Comparative analysis with established antigens:
PorA is under investigation as a potential antigen for inclusion in new meningococcal vaccines . Comparison of NMC1845 with PorA and other established vaccine candidates would provide valuable insights into its relative potential. Key considerations include:

  • Breadth of strain coverage

  • Stability of surface-exposed epitopes

  • Ability to elicit functional (bactericidal) antibodies

Recombinant protein advantages:
The availability of expression and purification systems for recombinant NMC1845 offers advantages for vaccine development:

  • Scalable production independent of pathogen cultivation

  • Potential for precise antigen engineering to enhance immunogenicity

  • Elimination of other bacterial components that might cause adverse effects

Delivery system considerations:
Various formulation approaches could be explored:

  • Inclusion in outer membrane vesicle (OMV) vaccines

  • Incorporation into liposomes or nanoparticles

  • Formulation with appropriate adjuvants to enhance immune responses

While specific immunological data for NMC1845 is not available in the provided search results, the established precedent of investigating meningococcal membrane proteins for vaccine development suggests this protein merits evaluation as a potential vaccine component.

How can researchers design experiments to evaluate the immunogenicity of recombinant NMC1845?

Evaluating the immunogenicity of recombinant NMC1845 requires a systematic approach:

In vitro immunological assays:

  • Antigen processing studies:

    • Assess uptake by antigen-presenting cells (APCs)

    • Evaluate processing and presentation of NMC1845-derived peptides

    • Measure activation of dendritic cells (upregulation of co-stimulatory molecules, cytokine production)

  • Antibody binding studies:

    • Generate polyclonal antibodies against recombinant NMC1845

    • Test antibody binding to live meningococci using flow cytometry

    • Perform Western blots to confirm specificity

  • Functional antibody assays:

    • Serum bactericidal assay (SBA) – gold standard for evaluating meningococcal vaccine responses

    • Opsonophagocytic killing assay (OPKA)

    • Surface labeling of bacteria using immunofluorescence microscopy

Animal immunization studies:

  • Study design considerations:

    • Select appropriate animal models (mice, rabbits, or non-human primates)

    • Compare different adjuvant formulations

    • Test prime-boost strategies

    • Include appropriate control groups

  • Immunization protocol:

    • Formulate purified recombinant NMC1845 with suitable adjuvants

    • Administer multiple doses to ensure robust immune responses

    • Collect serum samples at defined timepoints

  • Immune response analysis:

    • Measure NMC1845-specific antibody titers by ELISA

    • Determine antibody isotypes and subclasses

    • Assess T-cell responses using ELISpot or intracellular cytokine staining

    • Map B-cell and T-cell epitopes

  • Challenge studies:

    • Evaluate protection against meningococcal challenge in appropriate models

    • Assess bacterial burden in blood and tissues

    • Monitor survival and disease symptoms

Comparative immunogenicity:
Include established meningococcal antigens (like PorA) as benchmarks, since they are known to generate bactericidal immune responses . This allows direct comparison of NMC1845's immunogenic potential against validated vaccine antigens.

The experimental approach should be iterative, with initial studies informing subsequent optimization of antigen formulation, delivery methods, and adjuvant selection to maximize immune responses.

What are the challenges in translating recombinant NMC1845 from laboratory research to vaccine development?

Translating recombinant NMC1845 from laboratory research to vaccine development presents several significant challenges:

Antigenic variation challenges:

  • Neisseria meningitidis exhibits considerable strain variation

  • Assessment of NMC1845 sequence conservation across diverse clinical isolates is essential

  • Identification of conserved, surface-exposed epitopes that elicit protective immunity

Manufacturing and scale-up issues:

  • Current laboratory expression systems in E. coli may not be optimal for large-scale production

  • Membrane proteins often express at lower yields than soluble proteins

  • Process development for consistent, high-quality antigen production

  • Formulation stability and shelf-life considerations

Regulatory considerations:

  • Demonstration of consistent protein quality (purity, structure, freedom from contaminants)

  • Toxicology and safety testing requirements

  • Careful documentation of manufacturing processes

  • Design of appropriate clinical trials

Immunological challenges:

  • Potential for immunodominant non-protective epitopes

  • Need for appropriate adjuvants to enhance immunogenicity

  • Establishment of correlates of protection

  • Comparison with existing meningococcal vaccines

Practical vaccine implementation:

  • Integration with existing meningococcal vaccine approaches

  • Cost considerations for global deployment

  • Cold chain requirements

  • Dosing schedule optimization

The experience with similar membrane proteins like PorA offers valuable insights. PorA has been investigated as a potential vaccine antigen , yet challenges remain in developing broadly protective meningococcal vaccines based on protein antigens alone. A comprehensive approach integrating multiple antigens may ultimately prove most effective for meningococcal vaccine development.

How can cryo-electron microscopy be optimized for structural studies of NMC1845?

Cryo-electron microscopy (cryo-EM) offers significant advantages for membrane protein structural studies but requires specialized approaches for proteins like NMC1845:

Sample preparation optimization:

  • Membrane mimetic selection:

    • Nanodiscs with MSP1D1 or MSP1E3D1 scaffold proteins

    • Amphipols (A8-35 or PMAL-C8)

    • Detergent micelles (preferably with larger micelles like DDM or GDN)

    • Lipid nanodiscs with varied lipid compositions mimicking meningococcal membranes

  • Protein engineering strategies:

    • Fusion with megabodies or nanobodies to increase molecular weight

    • Complex formation with antibody fragments (Fab)

    • Introduction of stabilizing mutations based on computational predictions

  • Vitrification optimization:

    • Systematic testing of blotting times and temperatures

    • Grid type selection (gold versus copper, holey carbon patterns)

    • Surface treatment (glow discharge conditions, graphene coating)

Data collection strategies:

  • Microscope parameters:

    • High-end electron microscopes (300 kV preferred for membrane proteins)

    • Direct electron detectors with high detective quantum efficiency

    • Energy filters to improve contrast

    • Phase plates for small proteins (<100 kDa)

  • Collection conditions:

    • Dose fractionation (40-50 frames per exposure)

    • Total dose limitation (50-70 e-/Å2) to minimize radiation damage

    • Defocus range optimization (-0.8 to -2.5 μm)

    • Tilt series collection to address preferred orientation issues

Data processing considerations:

  • Particle picking approaches:

    • Template-based versus reference-free methods

    • Neural network-based algorithms for challenging membrane protein datasets

  • Classification strategies:

    • 2D classification to identify homogeneous particle populations

    • 3D classification to resolve conformational heterogeneity

    • Signal subtraction to focus refinement on protein versus detergent micelle

  • Validation methods:

    • Map-model validation with atomic models

    • Tilt-pair validation

    • Local resolution estimation

For NMC1845 specifically, researchers should consider consulting the Membrane Protein Data Bank (MPDB) for examples of successful cryo-EM studies on related bacterial membrane proteins to guide experimental design and data analysis strategies.

What approaches can researchers use to study protein-protein interactions involving NMC1845 in the bacterial membrane?

Studying protein-protein interactions involving membrane proteins like NMC1845 in their native environment requires specialized methods:

In vivo interaction methods:

  • Genetic approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Suppressor mutation analysis to identify functional interactions

    • Co-evolution analysis to predict interaction partners

  • Crosslinking strategies:

    • in vivo photo-crosslinking with genetically incorporated UV-activatable amino acids

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Proximity-dependent biotin labeling (BioID or APEX2)

  • Fluorescence-based methods:

    • Förster resonance energy transfer (FRET) with genetically encoded fluorescent proteins

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence recovery after photobleaching (FRAP) to assess co-diffusion

In vitro and structural methods:

  • Co-purification approaches:

    • Tandem affinity purification with NMC1845 as bait

    • Co-immunoprecipitation with antibodies against NMC1845

    • Pull-down assays with recombinant NMC1845

  • Biophysical interaction analysis:

    • Microscale thermophoresis (MST) with labeled membrane protein complexes

    • Surface plasmon resonance (SPR) with immobilized NMC1845

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine complex stoichiometry

  • Structural studies of complexes:

    • Cryo-electron microscopy of membrane protein complexes

    • X-ray crystallography of co-purified complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

Computational prediction approaches:

  • Molecular docking simulations

  • Coarse-grained molecular dynamics of multi-protein assemblies

  • Network analysis of genetic and proteomic data to predict functional associations

For NMC1845, initial studies might focus on identifying interaction partners within the Neisseria meningitidis membrane using approaches like proximity labeling or crosslinking mass spectrometry, followed by validation and detailed characterization of specific interactions using the methods outlined above.

How can researchers apply advanced mass spectrometry techniques to study post-translational modifications of NMC1845?

Mass spectrometry offers powerful approaches for characterizing post-translational modifications (PTMs) of membrane proteins like NMC1845:

Sample preparation considerations:

  • Enrichment strategies:

    • Immunoprecipitation of NMC1845 from Neisseria meningitidis

    • Affinity purification of recombinant tagged protein

    • Subcellular fractionation to isolate membrane fractions

  • Protein digestion approaches:

    • Multi-enzyme digestion (combining trypsin with alternative proteases like chymotrypsin)

    • In-solution versus in-gel digestion protocols

    • Filter-aided sample preparation (FASP) for membrane proteins

    • Limited proteolysis to access transmembrane regions

  • PTM-specific enrichment:

    • Titanium dioxide for phosphopeptides

    • Hydrazide chemistry for glycopeptides

    • Antibody-based enrichment for specific modifications

Mass spectrometry techniques:

  • Instrumentation selection:

    • High-resolution mass spectrometers (Orbitrap or Q-TOF)

    • Fragmentation methods optimized for PTM analysis (ETD, EThcD, or UVPD)

    • Ion mobility to separate isobaric species

  • Data acquisition strategies:

    • Data-dependent acquisition with neutral loss scanning

    • Parallel reaction monitoring (PRM) for targeted PTM analysis

    • Data-independent acquisition (DIA) for comprehensive coverage

  • Quantitative approaches:

    • Label-free quantification of modification stoichiometry

    • Stable isotope labeling to compare modification states

    • Multiple reaction monitoring (MRM) for targeted quantification

Data analysis considerations:

  • Search algorithms:

    • Open and variable modification searches

    • Spectral library matching

    • De novo sequencing approaches

  • Validation strategies:

    • Manual verification of MS/MS spectra

    • False discovery rate control

    • Orthogonal validation (e.g., Western blotting with modification-specific antibodies)

  • Functional correlation:

    • Mapping modifications to protein structure

    • Temporal analysis of modification patterns

    • Correlation with bacterial physiology or pathogenesis

According to the neXtProt database, comprehensive PTM mapping can identify key regulatory modifications that affect protein function . For NMC1845, researchers should pay particular attention to modifications that might regulate membrane insertion, protein-protein interactions, or immunological properties, as these could be functionally significant and potentially relevant for vaccine development considerations .

How can researchers design effective controls for NMC1845 functional studies?

Designing robust controls is essential for reliable functional characterization of NMC1845:

Genetic controls:

  • Gene deletion and complementation:

    • Generate NMC1845 deletion mutant in Neisseria meningitidis

    • Complement with wild-type NMC1845 (positive control)

    • Complement with point mutants to assess structure-function relationships

    • Include empty vector control

  • Heterologous expression systems:

    • Express NMC1845 in E. coli lacking similar membrane proteins

    • Use strains optimized for membrane protein expression

    • Include non-expressing controls with empty vector

  • Tagged protein variants:

    • Create function-preserving tagged versions (e.g., His-tagged )

    • Generate non-functional mutants as negative controls

    • Use unrelated membrane proteins as specificity controls

Biochemical controls:

  • Protein quality controls:

    • Assess protein folding using circular dichroism

    • Verify membrane insertion using proteoliposome flotation assays

    • Include heat-denatured protein as negative control

    • Verify >90% purity by SDS-PAGE

  • Functional assay controls:

    • Use well-characterized membrane proteins with similar functions

    • Include buffer-only and empty liposome controls

    • Test across relevant physiological conditions (pH, temperature, ion concentrations)

  • Interaction specificity controls:

    • Include non-specific binding partners

    • Perform competition assays with excess unlabeled protein

    • Test interaction in multiple buffer conditions

Statistical considerations:

  • Design experiments with sufficient replicates (minimum triplicates)

  • Include appropriate statistical tests based on data distribution

  • Determine sample sizes based on power calculations

  • Control for batch effects in purification and assay performance

For experimental research with NMC1845, employing the gold standard design of true experimental approaches with appropriate controls is essential, as this provides the highest internal validity when examining cause-effect relationships . When published, results should clearly document all control experiments to enable proper interpretation and reproducibility.

What statistical approaches are most appropriate for analyzing data from NMC1845 structure-function studies?

Selecting appropriate statistical approaches for NMC1845 structure-function studies ensures reliable interpretation of experimental data:

Descriptive statistics fundamentals:

  • Data characterization:

    • Central tendency measures (mean, median) for functional parameters

    • Dispersion measures (standard deviation, interquartile range)

    • Graphical representations (box plots, scatter plots) to visualize distributions

  • Normality testing:

    • Shapiro-Wilk or Kolmogorov-Smirnov tests to assess distribution

    • Q-Q plots for visual assessment of normality

    • Transform data if necessary (log, square root) to meet parametric test assumptions

Inferential statistics selection:

  • Comparative analyses:

    • t-tests for comparing two conditions (wild-type vs. mutant)

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data

    • Mixed-model repeated measures for time-course experiments

  • Correlation and regression:

    • Pearson or Spearman correlation to quantify relationships between variables

    • Linear or non-linear regression to model functional relationships

    • Multiple regression for complex relationships with several predictors

  • Special considerations for membrane protein studies:

    • Curve fitting for dose-response relationships

    • Kinetic parameter estimation (Km, Vmax) with appropriate error analysis

    • Statistical comparison of fitted parameters across experimental conditions

Advanced analytical approaches:

  • Multivariate methods:

    • Principal component analysis (PCA) to identify patterns in complex datasets

    • Cluster analysis to identify functional groupings of variants

    • Discriminant analysis to classify variants based on functional profiles

  • Bayesian approaches:

    • Bayesian inference for robust parameter estimation

    • Markov Chain Monte Carlo (MCMC) simulations for complex models

    • Hierarchical modeling to account for experimental variability

For experimental designs examining NMC1845, statistical approaches similar to those used in clinical trials might be appropriate, such as mixed model repeated measures (MMRM) with proper attention to variance/covariance structure . The selection of appropriate statistical tests should be guided by the specific research question, data characteristics, and experimental design.

How can researchers integrate structural biology, biochemistry, and cellular approaches to comprehensively characterize NMC1845?

A comprehensive characterization of NMC1845 requires integrating multiple experimental approaches:

Integration framework:

  • Sequential multi-technique pipeline:

    • Begin with bioinformatic analysis and homology modeling

    • Progress to recombinant expression and purification

    • Perform structural studies (X-ray crystallography, cryo-EM, or NMR)

    • Conduct functional assays informed by structural insights

    • Validate in cellular and in vivo contexts

  • Parallel investigation tracks:

    • Structure determination team working alongside functional characterization team

    • Cellular biology studies conducted in parallel with biochemical characterization

    • Computational modeling informing and being refined by experimental data

  • Iterative feedback loop:

    • Structural insights guide mutagenesis for functional studies

    • Functional data refines structural hypotheses

    • Cellular phenotypes inform biochemical assay design

Cross-disciplinary experimental approaches:

Technique CategorySpecific MethodsInformation Provided
Structural BiologyX-ray crystallographyHigh-resolution static structure
Cryo-electron microscopyStructure in near-native environment
NMR spectroscopyDynamic information and ligand interactions
Small-angle X-ray scatteringSolution structure and conformational states
BiochemistrySite-directed mutagenesisStructure-function relationships
Binding assays (ITC, SPR, MST)Interaction parameters and affinity constants
Reconstitution in liposomesFunctional activity in membrane context
Mass spectrometryPost-translational modifications and interactions
Cellular BiologyLocalization studiesSubcellular distribution in Neisseria
Knockout/complementationPhysiological roles and essentiality
Bacterial phenotypic assaysContribution to bacterial physiology
Infection modelsRole in pathogenesis

Data integration strategies:

  • Structural-functional mapping:

    • Map functional data onto 3D structures

    • Identify critical regions for activity, interaction, and regulation

    • Visualize evolutionary conservation in structural context

  • Systems biology approaches:

    • Place NMC1845 in protein interaction networks

    • Integrate with transcriptomic and proteomic datasets

    • Model pathway contributions and systems-level effects

  • Translational integration:

    • Connect basic characterization to vaccine development potential

    • Identify structure-based epitopes for immunological testing

    • Design rational modifications to enhance desired properties

This integrated approach maximizes the value of the recombinant NMC1845 protein resource and ensures that structural insights inform functional understanding, while cellular and in vivo studies provide physiological context for biochemical observations. The IMPACT-TWIN expression system used successfully for related meningococcal membrane proteins could provide the high-quality protein necessary for these multidisciplinary studies .

What are the future research directions for NMC1845 characterization?

Future research on NMC1845 should address current knowledge gaps through integrated approaches spanning multiple disciplines:

Structural biology frontiers:

  • High-resolution structure determination using cryo-EM or X-ray crystallography

  • Conformational dynamics studies using hydrogen-deuterium exchange mass spectrometry

  • Investigation of protein-lipid interactions in native-like membrane environments

Functional characterization priorities:

  • Definitive establishment of NMC1845's membrane transport or signaling properties

  • Identification of substrate specificity if it functions as a transporter

  • Elucidation of regulation mechanisms and interaction partners

Genetic and cellular approaches:

  • Gene knockout studies in Neisseria meningitidis to determine physiological roles

  • Global interaction studies using proximity labeling techniques

  • Transcriptomic and proteomic analysis of strains with altered NMC1845 expression

Immunological and vaccine development:

  • Epitope mapping to identify immunologically relevant regions

  • Assessment of conservation across meningococcal strains

  • Evaluation of protective potential as a vaccine antigen building on knowledge from related proteins like PorA

Technological innovations:

  • Development of nanobody or aptamer tools for studying NMC1845 in native contexts

  • Application of advanced imaging techniques (super-resolution microscopy, correlative light-electron microscopy)

  • Computational approaches for predicting drug binding sites if NMC1845 emerges as a therapeutic target

Research on NMC1845 will benefit from the growing toolkit for membrane protein research and could provide valuable insights into meningococcal biology, potentially contributing to new therapeutic or preventive strategies against meningococcal disease. Leveraging established expression systems and building on what is known about related membrane proteins will accelerate progress in understanding this bacterial membrane protein.

How might findings from NMC1845 research impact broader understanding of bacterial membrane proteins?

Research on NMC1845 has potential to impact multiple areas of bacterial membrane protein biology:

Methodological advancements:

  • Optimization of expression and purification protocols for difficult membrane proteins

  • Refinement of structural biology approaches for bacterial membrane proteins

  • Development of functional assays applicable to other uncharacterized membrane proteins

Structural biology insights:

  • Potential identification of novel structural motifs within the UPF0756 protein family

  • Improved understanding of membrane protein folding and stability determinants

  • Structure-based classification that clarifies evolutionary relationships among bacterial membrane proteins

Functional characterization paradigms:

  • New approaches for determining functions of uncharacterized membrane proteins

  • Insights into membrane protein dynamics and conformational changes

  • Understanding of how membrane proteins interact with the bacterial membrane environment

Vaccine development implications:

  • Improved strategies for designing membrane protein-based vaccines

  • Better understanding of immunogenic determinants in bacterial membrane proteins

  • New approaches for stabilizing and presenting membrane protein antigens

Bacterial physiology understanding:

  • Clarification of membrane protein roles in bacterial adaptation

  • Insights into meningococcal membrane organization and function

  • Potential discovery of novel virulence mechanisms

The recombinant expression systems developed for NMC1845 could serve as templates for other challenging bacterial membrane proteins, while structural and functional insights might reveal conserved principles applicable across diverse bacterial species. Additionally, if NMC1845 proves to have immunological significance similar to other meningococcal membrane proteins like PorA , this could inform broader vaccine development strategies against other bacterial pathogens.

What technological innovations are needed to overcome current limitations in studying proteins like NMC1845?

Advancing NMC1845 research requires overcoming several technological challenges:

Expression and purification innovations:

  • Development of specialized expression systems optimized for bacterial membrane proteins

  • Novel detergents and membrane mimetics that better preserve native structure and function

  • Automation of purification processes to improve reproducibility and throughput

  • Improved methods for assessing protein quality and homogeneity

Structural biology advancements:

  • Cryo-EM technological improvements for smaller membrane proteins

  • New crystallization methods specific for bacterial membrane proteins

  • Hybrid approaches combining multiple structural techniques for comprehensive characterization

  • Development of membrane-specific computational tools for structure prediction and refinement

Functional analysis tools:

  • High-throughput functional screening platforms for membrane proteins

  • Single-molecule techniques to study membrane protein dynamics

  • Advanced biosensors to monitor transport or signaling activities in real-time

  • Cell-free systems that recapitulate membrane protein function

In situ characterization methods:

  • Improved in vivo crosslinking technologies with higher specificity

  • Advanced imaging techniques with single-molecule resolution in bacterial cells

  • Methods to manipulate membrane proteins in their native context

  • Tools for temporal control of membrane protein expression and function

Data integration platforms:

  • Software for integrating structural, functional, and evolutionary data

  • Machine learning approaches to predict membrane protein function from sequence

  • Standardized databases for bacterial membrane protein information

  • Virtual reality visualization tools for complex membrane protein structures and interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.