Recombinant Neisseria meningitidis serogroup C / serotype 2a UPF0761 membrane protein NMC0462 (NMC0462)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced via recombinant DNA technology in E. coli and purified under denaturing conditions. Key production metrics include:

ParameterDetail
Expression SystemE. coli
FormLyophilized powder
Reconstitution0.1–1.0 mg/mL in deionized water + 50% glycerol
BufferTris/PBS-based, 6% trehalose, pH 8.0

Research Applications

NMC0462 is utilized in:

  • ELISA development: Commercial ELISA kits employ this protein for antibody detection .

  • Membrane protein studies: Its full-length structure facilitates investigations into meningococcal membrane biology .

  • Vaccine research: As a surface-exposed protein, it is a potential candidate for immunogen design .

Functional and Pathway Insights

While direct functional data for NMC0462 remain limited, bioinformatics links it to:

  • Membrane integrity: Predicted involvement in bacterial cell adhesion or nutrient transport due to transmembrane domains .

  • Pathogen-host interactions: Homology with other meningococcal proteins suggests roles in virulence .

Limitations and Future Directions

Current knowledge gaps include:

  • Pathway associations: No experimentally validated pathways are documented .

  • Interaction networks: Direct protein-protein interactions remain uncharacterized .

  • Structural data: High-resolution structures (e.g., cryo-EM) are lacking .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
NMC0462; UPF0761 membrane protein NMC0462
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Target Names
NMC0462
Target Protein Sequence
MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWRGEAFRRGFDSRGRFDDVLKILLLL DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQGWVLKTGADSIELNEL FKLFVYRPLPVERDHVNQAVDAVMTPCLQTLNMTLAEFDAQAKKQQQS
Uniprot No.

Target Background

Database Links

KEGG: nmc:NMC0462

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NMC0462 fit into the broader context of N. meningitidis virulence?

While specific virulence functions of NMC0462 are not directly established in the available literature, membrane proteins in N. meningitidis often play crucial roles in pathogenicity. N. meningitidis serogroup C is one of five serogroups (A, B, C, W135, and Y) most frequently associated with severe human disease . The serogroup classification is based on capsular polysaccharide structure, which is a primary virulence factor.

Researchers working with this protein should consider its potential contributions to membrane integrity, transport processes, or cell-cell interactions, all of which can influence bacterial pathogenicity in host-pathogen interactions.

What expression systems are most effective for producing functional recombinant NMC0462?

Based on the available information, E. coli has been successfully employed to express recombinant NMC0462 with an N-terminal His-tag . This approach provides several advantages for research applications, including:

  • High protein yield and established induction protocols

  • Compatibility with affinity chromatography purification methods

  • Simplified scale-up for larger preparations

  • Utilize specialized E. coli strains (such as C41/C43 or Lemo21) that are optimized for membrane protein expression

  • Implement low-temperature induction protocols (16-25°C) to reduce inclusion body formation

  • Consider codon optimization if expression levels are suboptimal

  • Evaluate alternative solubilization methods if protein functionality is compromised

For structural studies requiring higher purity or native conformation, researchers might consider:

  • Baculovirus-insect cell systems, which often provide better folding environments for complex membrane proteins

  • Cell-free expression systems that can directly incorporate the protein into nanodiscs or liposomes

  • Mammalian expression systems for studies requiring mammalian-specific post-translational modifications

Each expression system presents trade-offs between yield, functionality, and ease of use that should be evaluated based on the specific research objectives.

What are the optimal methods for solubilization and purification of NMC0462?

Successful purification of membrane proteins like NMC0462 requires careful consideration of detergent selection and purification conditions. Based on general principles for membrane protein purification and the available information on NMC0462, the following methodology is recommended:

  • Membrane Isolation and Solubilization:

    • Harvest cells and disrupt by sonication or French press

    • Separate membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Solubilize membranes using a detergent screening approach with candidates such as:

      • DDM (n-dodecyl-β-D-maltoside)

      • LMNG (lauryl maltose neopentyl glycol)

      • Digitonin (for sensitive membrane proteins)

  • Affinity Purification:

    • Utilize the His-tag for IMAC (immobilized metal affinity chromatography)

    • Employ a step gradient of imidazole (20-300 mM) to reduce non-specific binding

    • Include the optimal detergent at concentrations above CMC in all buffers

  • Secondary Purification:

    • Size exclusion chromatography to separate oligomeric states and remove aggregates

    • Consider ion exchange chromatography if charge-based separation would enhance purity

  • Quality Assessment:

    • SDS-PAGE and Western blot to confirm identity and purity

    • Circular dichroism to assess secondary structure integrity

    • Dynamic light scattering to evaluate homogeneity

For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to maintain native activity. The choice between these approaches depends on the specific assays planned and the protein's stability in different membrane mimetics.

How conserved is NMC0462 across different Neisseria meningitidis serogroups?

Understanding the conservation of NMC0462 across different N. meningitidis serogroups provides insights into its evolutionary importance and potential as a pan-serogroup research target. While comprehensive conservation data specifically for NMC0462 is not directly provided in the search results, we can infer methodological approaches for such analysis:

  • Sequence Homology Analysis:

    • Researchers should conduct BLAST analysis of NMC0462 against genomes of N. meningitidis serogroups A, B, W135, and Y

    • Perform multiple sequence alignment using tools like Clustal Omega or MUSCLE

    • Calculate percent identity and similarity metrics across serogroups

  • Genomic Context Evaluation:

    • Examine the genomic regions flanking NMC0462 orthologs

    • Determine if gene synteny is maintained across serogroups

    • Identify potential operon structures or regulatory elements

The high recombination rates observed in N. meningitidis genomes may affect the conservation of membrane proteins . Studies have shown that N. meningitidis is structured in phylogenetic clades that have acquired specific genes and genomic rearrangements . Therefore, researchers should examine whether NMC0462 is part of the core genome or associated with specific genetic lineages.

What functional differences might exist between NMC0462 and its homologs in other Neisseria species?

Functional diversification of membrane proteins often contributes to species-specific adaptations. To evaluate potential functional differences between NMC0462 and its homologs, researchers should consider:

  • Domain Architecture Analysis:

    • Identify conserved functional domains using tools like InterPro or Pfam

    • Map transmembrane topology predictions across homologs using TMHMM or Phobius

    • Detect species-specific insertions/deletions that might affect function

  • Evolutionary Rate Analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Analyze site-specific selection patterns to identify potentially functionally important residues

    • Compare evolutionary rates between commensal and pathogenic Neisseria species

  • Protein-Protein Interaction Network Comparison:

    • Conduct co-immunoprecipitation studies with tagged versions of NMC0462 from different species

    • Perform bacterial two-hybrid screening to identify interaction partners

    • Compare interactomes between species to identify functional divergence

N. meningitidis has evolved specific virulence mechanisms that distinguish it from commensal Neisseria species. The capsular polysaccharide, a key virulence factor, shows structural variation across serogroups . Similarly, membrane proteins like NMC0462 may have undergone functional adaptations related to pathogenicity or niche specialization.

How might NMC0462 contribute to membrane biogenesis in N. meningitidis?

Integral membrane proteins often play critical roles in membrane biogenesis processes. Current models for membrane protein insertion involve two major pathways: the Oxa1 family and the SecY family . These pathways differ in their ability to handle transmembrane domains flanked by hydrophilic segments of different lengths.

The potential role of NMC0462 in membrane biogenesis could be investigated through:

  • Pathway Identification:

    • Analyze the NMC0462 sequence for signal peptides and transmembrane domain arrangement

    • Determine if its topology suggests insertion via the Oxa1 pathway (for TMDs flanked by short translocated segments) or the SecY pathway (for TMDs flanked by long translocated segments)

    • Conduct depletion experiments of pathway components to identify the insertion machinery used

  • Functional Characterization:

    • Generate conditional knockdown or deletion mutants of NMC0462

    • Assess changes in membrane composition, fluidity, or asymmetry

    • Evaluate effects on the expression and localization of other membrane proteins

  • Interaction Studies:

    • Investigate potential interactions with components of the membrane protein insertion machinery

    • Identify chaperones or insertion factors that specifically recognize NMC0462

    • Determine if NMC0462 itself functions as a membrane protein biogenesis factor

Given that membrane proteins comprise approximately 25% of the proteome in all organisms , understanding the biogenesis of specific membrane proteins like NMC0462 could provide broader insights into bacterial membrane assembly processes.

What techniques are most informative for studying NMC0462 structure-function relationships?

Elucidating structure-function relationships for membrane proteins presents unique challenges. For NMC0462, researchers should consider a multi-pronged approach:

  • Structural Analysis:

    • Cryo-electron microscopy for high-resolution structure determination

    • X-ray crystallography (challenging for membrane proteins but can provide atomic resolution)

    • NMR spectroscopy for dynamic regions and ligand binding studies

    • Molecular dynamics simulations to model membrane interactions

  • Functional Mapping:

    • Site-directed mutagenesis of conserved residues

    • Domain swapping with homologs to identify specificity-determining regions

    • Cysteine scanning mutagenesis coupled with accessibility assays

    • Truncation analysis to define minimal functional units

  • Transport or Enzymatic Activity Characterization:

    • Reconstitution into proteoliposomes for transport assays

    • Substrate screening using fluorescent probes or radioligands

    • Electrophysiological measurements for potential channel activity

    • Enzymatic assays if catalytic activity is suspected

  • In vivo Functional Assessment:

    • Complementation studies with mutant variants

    • Bacterial two-hybrid screening to map interaction interfaces

    • Fluorescence microscopy to track localization and dynamics

    • Phenotypic assays to correlate structure with cellular function

The expanding toolkit for membrane protein research now includes advanced methods such as hydrogen-deuterium exchange mass spectrometry (HDX-MS), native mass spectrometry, and single-molecule FRET, which could provide valuable insights into NMC0462 dynamics and interactions.

What controls are essential when studying recombinant NMC0462 protein function?

  • Expression and Purification Controls:

    • Empty vector controls processed identically to NMC0462-expressing samples

    • His-tagged unrelated membrane protein as a tag-specific control

    • Native membrane preparations from N. meningitidis for comparison with recombinant protein

  • Functional Assay Controls:

    • Heat-denatured NMC0462 to distinguish specific activity from non-specific effects

    • Proteoliposomes/nanodiscs without incorporated protein

    • Known membrane proteins with established functions as positive controls

    • Competitive inhibitors if binding partners are identified

  • Specificity Controls:

    • Homologs from related Neisseria species to assess functional conservation

    • Point mutants of key residues to confirm structure-function relationships

    • Antibody blocking experiments to validate interaction specificity

  • System Validation Controls:

    • Verification of proper folding using circular dichroism or limited proteolysis

    • Assessment of oligomeric state using size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Confirmation of membrane integration using fluorescence-based techniques

These controls help distinguish genuine protein functions from artifacts and provide necessary context for interpreting experimental results. The importance of proper controls cannot be overstated, especially for challenging membrane proteins where folding and stability can significantly impact functional assays.

How can researchers address the challenges of membrane protein aggregation during NMC0462 studies?

Membrane protein aggregation is a common challenge that can compromise experimental outcomes. For NMC0462 research, the following methodological approaches can mitigate aggregation issues:

  • Optimization of Solubilization Conditions:

    • Systematic screening of detergent types, concentrations, and combinations

    • Evaluation of detergent-lipid mixtures to better mimic native membrane environment

    • Testing of amphipols or styrene-maleic acid copolymers (SMALPs) as alternatives to detergents

  • Buffer Optimization:

    • Screening of pH, ionic strength, and buffer components

    • Addition of stabilizing agents (glycerol, sucrose, specific lipids)

    • Inclusion of reducing agents if disulfide-mediated aggregation occurs

  • Process Modifications:

    • Maintaining low temperatures throughout purification

    • Minimizing concentration steps and mechanical stress

    • Adding specific lipids identified in the native membrane environment

  • Aggregation Monitoring and Removal:

    • Regular dynamic light scattering measurements during purification

    • Implementation of filtration or centrifugation steps to remove aggregates

    • Size exclusion chromatography as a final polishing step

  • Alternative Approaches:

    • Direct extraction using styrene-maleic acid copolymers to maintain native lipid environment

    • Cell-free expression with immediate incorporation into nanodiscs

    • Fragment-based approaches focusing on stable domains

Researchers should systematically document aggregation propensity under different conditions, creating a stability profile that guides experimental design. The reconstitution process is particularly critical, as rapid detergent removal can lead to aggregation rather than proper membrane incorporation.

What criteria should be evaluated to assess NMC0462 as a potential vaccine target?

While the search results don't specifically address NMC0462 as a vaccine candidate, general principles for evaluating membrane proteins as vaccine targets can be applied. Researchers should systematically assess:

  • Antigen Conservation and Expression:

    • Sequence conservation across clinically relevant strains and serogroups

    • Expression levels during infection and in different growth conditions

    • Temporal expression patterns during disease progression

  • Surface Accessibility:

    • Topology prediction to identify externally exposed epitopes

    • Antibody accessibility studies using whole-cell ELISA or flow cytometry

    • Protease susceptibility mapping of purified protein

  • Immunogenicity Assessment:

    • B-cell epitope prediction and validation

    • T-cell epitope identification for cellular immunity

    • Animal immunization studies to assess antibody titers and specificity

  • Functional Significance:

    • Generation of conditional knockdowns to assess viability

    • Evaluation of protein role in adhesion, invasion, or nutrient acquisition

    • Assessment of antibody-mediated inhibition of protein function

  • Practical Considerations:

    • Recombinant production feasibility in vaccine-compatible systems

    • Stability of purified protein or identified epitopes

    • Compatibility with adjuvants and delivery platforms

N. meningitidis serogroup C is already targeted by capsular polysaccharide vaccines , so a protein-based approach targeting NMC0462 would need to demonstrate additional benefits such as broader strain coverage or enhanced protection. The identification of serogroup C ST-7 strains that may have undergone capsular switching from serogroup A highlights the potential value of conserved protein antigens that could provide protection across serogroups.

How should researchers approach data integration when studying NMC0462 in the context of systems biology?

Systems biology approaches can provide holistic insights into membrane protein function. For comprehensive analysis of NMC0462, researchers should integrate data from multiple platforms:

  • Multi-omics Integration:

    • Correlate transcriptomic data on NMC0462 expression with proteomics data

    • Integrate metabolomic changes in NMC0462 mutants with functional pathways

    • Analyze lipidomic alterations to identify potential interactions with specific lipids

  • Network Analysis:

    • Construct protein-protein interaction networks centered on NMC0462

    • Identify co-expressed genes using correlation networks

    • Map genetic interactions through synthetic lethality screening

  • Structural Integration:

    • Combine structural data with evolutionary conservation mapping

    • Integrate molecular dynamics simulations with experimental binding data

    • Correlate structural features with functional domains

  • Phenotypic Correlation:

    • Link phenotypic changes in mutants to molecular interactions

    • Correlate virulence phenotypes with expression patterns

    • Map contributions to membrane integrity or transport functions

What bioinformatic approaches are most valuable for predicting NMC0462 function?

Given the limited direct functional information available for NMC0462, computational prediction approaches can guide experimental design:

  • Sequence-Based Prediction:

    • Hidden Markov Model (HMM) profiling for domain identification

    • Transmembrane topology prediction using consensus approaches (TMHMM, TOPCONS)

    • Identification of functional motifs and binding sites using PROSITE or MotifFinder

  • Structure-Based Prediction:

    • Homology modeling using related proteins of known structure

    • Ab initio modeling approaches specifically designed for membrane proteins

    • Molecular docking to predict potential binding partners or substrates

  • Evolutionary Analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Detection of evolutionary rate shifts suggesting functional specialization

    • Identification of co-evolving residues suggesting functional coupling

  • Genome Context Methods:

    • Operon structure analysis to identify functionally related genes

    • Regulatory network reconstruction to place NMC0462 in cellular pathways

    • Comparative genomics to identify conserved genomic neighborhoods

  • Integrative Approaches:

    • Machine learning methods combining multiple features

    • Network-based function prediction using guilt-by-association principles

    • Text mining of scientific literature for implicit functional relationships

These computational predictions should generate testable hypotheses rather than definitive functional assignments. The results should be validated through targeted experimental approaches, gradually building a functional profile of NMC0462 and its role in N. meningitidis biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.