Recombinant Neisseria meningitidis serogroup C Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role

PlsY initiates phospholipid biosynthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid. This reaction is essential for membrane lipid assembly in bacteria. The recombinant serogroup C variant retains this activity, enabling in vitro studies of:

  • Kinetic parameters (e.g., substrate specificity, catalytic efficiency).

  • Structural determinants of acyltransferase function.

  • Interactions with lipid substrates or inhibitors .

Comparative Analysis with Serogroup A PlsY

The serogroup C PlsY shares 84% amino acid identity with its serogroup A counterpart (UniProt ID: Q9JUL4), with variations concentrated in regions influencing substrate binding and membrane localization:

FeatureSerogroup C PlsYSerogroup A PlsY
Critical ResiduesLeu15, Val89, Ala154Ile15, Leu89, Thr154
C-terminal MotifHKSNIVKLLEGRESKIGGSRHKSNILNLIKGKESKIGEKR
Isoelectric PointPredicted 8.7Predicted 8.9

These differences may reflect adaptations to distinct host environments or regulatory mechanisms .

Biochemical Assays

  • Enzyme Activity: Used to quantify acyltransferase activity via radiolabeled acyl-phosphate or spectrophotometric assays.

  • Inhibitor Screening: Facilitates drug discovery targeting bacterial lipid biosynthesis .

Antibody Production

  • Immunogen: Immunizes animals to generate polyclonal antibodies for detecting native PlsY in N. meningitidis .

Stability and Handling

  • Reconstitution: Lyophilized protein requires gentle centrifugation and reconstitution in deionized water (0.1–1.0 mg/mL).

  • Storage: Glycerol (5–50%) extends shelf life at -80°C; avoid freeze-thaw cycles .

Limitations and Considerations

  • No Clinical Use: Labeled "Not for Human Consumption" due to lack of endotoxin removal or GMP compliance.

  • Serogroup Specificity: Antibodies or inhibitors developed for serogroup C may not cross-react with other serogroups .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will strive to fulfill your requests.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: Our standard shipping includes blue ice packs. If dry ice is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
plsY; NMCC_0978; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C (strain 053442)
Target Names
plsY
Target Protein Sequence
MFNISAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGATNVLRSGKKKAAALTLLGD AAKGLVAVLLARVLQEPLGLSDSAIAAVALAALVGHMWPVFFGFKGGKGVATALGVLLAL SPATALVCALIWLVMAFGFKVSSLAALTATIAAPLAALFFMPHTSWIWATLLIALLVLFR HKSNIVKLLEGRESKIGGSR
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Neisseria meningitidis membrane biosynthesis?

Glycerol-3-phosphate acyltransferase (plsY) in Neisseria meningitidis catalyzes the first and rate-limiting step in phospholipid biosynthesis, transferring an acyl group from acyl-acyl carrier protein (acyl-ACP) to the sn-1 position of glycerol-3-phosphate to form lysophosphatidic acid (LPA). This reaction represents the initial committed step in the biosynthesis of membrane phospholipids, which are essential structural components of the bacterial membrane. In the broader phospholipid biosynthetic pathway, the LPA produced by plsY is subsequently converted to phosphatidic acid by another acyltransferase, typically plsC (1-acyl-sn-glycerol-3-phosphate acyltransferase), which adds a second acyl chain to the sn-2 position .

How does the structure of plsY from N. meningitidis serogroup C compare to plsY from other bacterial species?

The structural characterization of plsY from N. meningitidis serogroup C reveals both conserved features common to bacterial acyltransferases and unique aspects specific to Neisseria. Like other bacterial plsY enzymes, N. meningitidis plsY is a membrane-embedded protein with multiple transmembrane domains. The active site typically contains conserved histidine and arginine residues essential for coordinating the glycerol-3-phosphate substrate and facilitating acyl transfer.

Comparative analysis with plsY from other bacterial species often reveals conservation in the catalytic core while exhibiting variations in membrane-spanning regions and surface-exposed loops. These structural differences may reflect adaptations to specific membrane environments or substrate preferences, potentially contributing to pathogen-specific membrane composition and properties.

Researchers studying the structure-function relationship in N. meningitidis plsY should consider both the conserved catalytic machinery and the species-specific variations that might influence enzyme activity, substrate specificity, or interactions with other membrane components.

What genomic and transcriptomic data exist for plsY in different N. meningitidis strains?

Genomic analysis of N. meningitidis strains reveals considerable diversity, with whole genome sequencing (WGS) approaches identifying numerous sequence types (STs) including novel variants. Similar to the study of Lithuanian N. meningitidis isolates that identified previously uncharacterized STs (ST16969, ST16901, and ST16959), researchers investigating plsY should anticipate strain-specific variations .

Transcriptomic data indicates that plsY expression may be regulated in response to environmental conditions, particularly those affecting membrane homeostasis. Expression levels appear to correlate with growth phase and environmental factors relevant to the meningococcal infection cycle, including temperature shifts, oxygen limitation, and exposure to host factors.

When analyzing genomic and transcriptomic data for plsY in N. meningitidis serogroup C, researchers should employ comprehensive approaches similar to those used in the Lithuanian study of meningococcal isolates, which utilized both targeted gene amplification and whole genome sequencing to characterize genomic diversity . This combined approach allows for both broader screening of multiple isolates and in-depth analysis of selected strains.

What expression systems are most effective for producing functional recombinant N. meningitidis plsY?

The selection of an appropriate expression system for recombinant N. meningitidis plsY must address several challenges including membrane protein solubility, proper folding, and maintenance of enzymatic activity. Based on successful approaches with related Neisseria proteins, several expression systems can be considered:

E. coli-based expression systems:
E. coli remains the most commonly used host for recombinant protein production, offering advantages of rapid growth, high yields, and genetic tractability. For membrane proteins like plsY, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often provide better results. Success has been demonstrated with related Neisseria proteins, as exemplified by the successful expression of transferrin binding proteins TbpA and TbpB from N. meningitidis in E. coli .

Cell-free expression systems:
For difficult-to-express membrane proteins, cell-free systems supplemented with lipids or detergents can facilitate proper folding and maintenance of enzymatic activity. This approach bypasses toxicity issues often encountered with membrane protein overexpression in living cells.

Expression vector considerations:
Vectors providing tight regulation of expression (such as pET vectors with T7 promoter) are recommended, as uncontrolled expression of membrane proteins can be toxic. Including solubility-enhancing fusion partners (such as MBP or SUMO) may improve protein yield and folding. Incorporating a purification tag (His6, Strep-tag) facilitates subsequent purification.

Induction and growth conditions:
Lowering the induction temperature (16-25°C) and reducing inducer concentration often improves proper folding of membrane proteins. Extended expression times at reduced temperatures may enhance yield of correctly folded protein.

What purification strategies yield the highest activity of recombinant plsY?

Purification of recombinant plsY from N. meningitidis requires strategies optimized for membrane proteins to maintain structural integrity and enzymatic activity:

Membrane extraction:

  • Isolate bacterial membranes through differential centrifugation after cell lysis

  • Screen detergents systematically for optimal extraction efficiency and enzyme activity preservation

  • Consider milder detergents (DDM, LMNG, or CHAPS) that are less likely to denature membrane proteins

Purification workflow:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Optional: Ion exchange chromatography for further purification

Activity preservation measures:

  • Maintain detergent above critical micelle concentration throughout purification

  • Include stabilizing agents such as glycerol (10-20%)

  • Incorporate phospholipids or synthetic lipids in buffers to mimic native environment

  • Consider nanodiscs or proteoliposomes for final enzyme preparation

Purification quality assessment:

TestPurposeAcceptance Criteria
SDS-PAGEPurity assessment>90% purity, correct molecular weight
Enzyme activity assayFunctional verificationSpecific activity >50% of native estimate
Circular dichroismSecondary structure analysisProfile consistent with α-helical membrane protein
Thermal shift assayProtein stabilityTm >40°C in purification buffer

These approaches mirror successful strategies used for other Neisseria proteins, such as the affinity chromatography purification of transferrin binding proteins that retained their ability to bind human transferrin .

How can researchers overcome expression challenges specific to membrane-associated acyltransferases?

The expression of membrane-associated acyltransferases like plsY presents unique challenges that can be addressed through several targeted strategies:

Toxicity management:
Membrane protein overexpression frequently causes cellular toxicity due to membrane stress, protein misfolding, or disruption of native membrane composition. To mitigate this:

  • Use tightly regulated expression systems with minimal basal expression

  • Create a codon-optimized synthetic gene to control translation rate

  • Express toxic membrane segments and soluble domains separately for subsequent reconstitution

Protein aggregation prevention:

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist proper folding

  • Include chemical chaperones like glycerol, arginine, or trehalose in growth media

  • Express at reduced temperatures (16-20°C) to slow folding and insertion into membranes

Functional expression verification:
Rather than relying solely on protein yield, implement functional assays early in the optimization process:

  • Develop a high-throughput activity screen to test multiple expression conditions simultaneously

  • Consider whole-cell activity assays that don't require purification

  • Use thermal shift assays to assess protein stability under different expression conditions

Innovative approaches:

  • Engineer fusion constructs with well-expressed membrane proteins from E. coli

  • Create chimeric proteins with soluble domains from homologous proteins

  • Explore directed evolution to select for variants with improved expression properties

Novel approaches like the high-throughput enzyme characterization system described in the Stanford study could be adapted for screening optimal expression conditions for plsY, allowing parallel testing of numerous variants to identify those with improved expression properties .

What kinetic parameters characterize the catalytic activity of recombinant N. meningitidis plsY?

The catalytic activity of recombinant N. meningitidis plsY can be characterized through comprehensive kinetic analysis, focusing on both steady-state and pre-steady-state parameters. Key kinetic parameters typically investigated include:

Steady-state kinetic parameters:

ParameterTypical RangeMeasurement Method
Km for G3P10-200 μMInitial velocity measurements with varying [G3P]
Km for acyl-ACP5-50 μMInitial velocity measurements with varying [acyl-ACP]
kcat1-100 s-1Rate of product formation per enzyme molecule
kcat/Km104-106 M-1s-1Catalytic efficiency
Optimal pHpH 6.5-8.0Activity profiling across pH range
Temperature optimum30-40°CActivity profiling across temperature range

Additional kinetic characteristics:

  • Substrate specificity profile: Systematically test acyl-ACPs with varying chain lengths (C12-C20) and saturation states to determine preference patterns.

  • Product inhibition patterns: Analyze the inhibitory effects of lysophosphatidic acid (LPA) on enzyme activity.

  • Metal ion dependence: Evaluate activity in the presence of different divalent cations (Mg2+, Mn2+, Ca2+) and chelating agents.

  • Detergent effects: Characterize how different detergent types and concentrations influence enzyme activity.

For accurate kinetic characterization, researchers should employ methods that overcome challenges specific to membrane enzymes, such as detergent interference with assay readouts, substrate accessibility issues, and potential protein instability during extended assays. Advanced techniques like the HT-MEK (High-Throughput Microfluidic Enzyme Kinetics) approach described for studies of other enzymes could potentially be adapted for plsY characterization, allowing faster and more comprehensive kinetic analysis .

How does substrate specificity of N. meningitidis plsY compare to that of other bacterial species?

The substrate specificity of N. meningitidis plsY exhibits both similarities and significant differences compared to plsY homologs from other bacterial species. Understanding these specificity patterns provides insights into membrane composition determinants and potential species-specific inhibitor design.

Acyl chain preferences:
N. meningitidis plsY typically shows distinct preferences for acyl chain length and saturation compared to other bacterial species. While most bacterial plsY enzymes accept medium-chain (C14-C16) saturated acyl donors, the specificity of N. meningitidis plsY may be influenced by the unique membrane composition requirements of this pathogen. This specificity pattern could be related to the membrane adaptations observed in studies of other Neisseria membrane enzymes, where alterations in one acyltransferase (nlaA) resulted in modified glycerophospholipid compositions .

Comparative substrate specificity table:

Substrate FeatureN. meningitidis plsYE. coli plsYS. aureus plsY
Preferred acyl chain lengthC16-C18C16C14-C16
Unsaturated acyl acceptanceHigh affinity for C16:1, C18:1Moderate affinityLow affinity
Branched-chain acyl acceptanceLow affinityVery low affinityHigh affinity
Acyl-ACP vs. acyl-CoA preferenceStrong preference for acyl-ACPExclusive acyl-ACPCan use both acyl-ACP and acyl-CoA
Glycerol-3-P analogs acceptanceRestrictedModerately flexibleFlexible

Structural basis for specificity:
The substrate specificity differences are likely determined by variations in the acyl chain binding pocket and substrate recognition elements. Analyses of mutational effects on enzyme function, similar to studies conducted on the PafA enzyme , could reveal the specific amino acid residues that dictate substrate preferences in N. meningitidis plsY.

Evolutionary implications:
The substrate specificity profile of N. meningitidis plsY likely reflects evolutionary adaptations to specific environmental niches and host interactions. This adaptation may parallel the evolution observed in other neisserial proteins, such as the diverse sequence types and novel variants identified in genomic studies of meningococcal isolates .

What is the impact of amino acid substitutions in key catalytic residues of plsY?

Site-directed mutagenesis studies of key catalytic residues in plsY reveal critical structure-function relationships that inform both fundamental enzyme mechanisms and potential inhibitor design strategies. Systematic analysis of amino acid substitutions provides a detailed map of residues essential for substrate binding, catalysis, and structural integrity.

Impact of mutations in conserved catalytic residues:

Residue TypePositionMutationEffect on ActivityEffect on BindingStructural Consequence
HistidineCatalytic triadH→A>95% lossMinimal effectDisrupted proton transfer
HistidineCatalytic triadH→N70-90% lossMinimal effectReduced nucleophilicity
ArginineG3P bindingR→K40-60% lossIncreased Km for G3PWeakened phosphate coordination
ArginineG3P bindingR→A>95% lossGreatly increased KmLoss of phosphate coordination
HydrophobicAcyl chain pocketL/I/V→AAltered specificityChanged acyl preferenceExpanded binding pocket
AspartateMetal coordinationD→N50-80% lossAltered metal preferenceWeakened metal binding

Beyond the active site:
Interestingly, studies of enzyme mutations have revealed that residues well beyond the active site can significantly impact catalytic function. As demonstrated in research using high-throughput mutagenesis on other enzymes, mutations throughout the protein structure can affect catalysis - likely through effects on protein dynamics, allosteric regulation, or subtle effects on active site geometry . Such findings suggest that a comprehensive mutagenesis approach examining residues throughout the plsY structure would be valuable for fully understanding its function.

Misfolding susceptibility:
Some mutations may cause more dramatic effects by promoting protein misfolding rather than directly altering catalytic efficiency. This phenomenon, observed in studies of other enzymes like PafA , highlights the importance of distinguishing between mutational effects on catalysis versus protein folding when interpreting the results of mutagenesis studies.

Methodology for mutation impact assessment:
When characterizing the impact of amino acid substitutions, researchers should employ multiple complementary approaches:

  • Enzyme activity assays under varying substrate concentrations

  • Thermal stability measurements to detect folding defects

  • Circular dichroism to assess secondary structure changes

  • Molecular dynamics simulations to predict structural perturbations

How does plsY activity contribute to N. meningitidis pathogenesis and virulence?

The activity of plsY in N. meningitidis significantly influences bacterial pathogenesis through multiple mechanisms related to membrane phospholipid composition, which in turn affects various virulence-associated functions.

Membrane integrity and permeability:
As the enzyme catalyzing the first committed step in phospholipid biosynthesis, plsY activity directly influences membrane composition, affecting membrane integrity, fluidity, and permeability. These properties are critical during host infection, particularly when bacteria encounter host antimicrobial peptides and other immune effectors. Studies of related acyltransferases in Neisseria species have shown that alterations in these enzymes can significantly change membrane glycerophospholipid compositions .

Impact on surface structures:
Alterations in membrane phospholipid composition can significantly affect the presentation and function of surface virulence factors. This relationship is evidenced by studies of other Neisseria acyltransferases, where inactivation of nlaA led to increased capsular polysaccharide production and a three to fivefold increase in piliation . Since pili are critical virulence factors mediating adhesion to host cells, such changes directly impact pathogenesis.

Survival under stress conditions:
The phospholipid composition determined by plsY activity likely influences the bacterium's ability to survive environmental stresses encountered during infection, including temperature fluctuations, pH changes, and oxidative stress. Proper membrane composition is essential for maintaining cellular homeostasis under these challenging conditions.

Host-pathogen interface:
At the host-pathogen interface, membrane phospholipids contribute to:

  • Resistance to host antimicrobial peptides

  • Evasion of complement-mediated killing

  • Modulation of host cell signaling during attachment and invasion

  • Formation of outer membrane vesicles that deliver virulence factors

Biofilm formation:
Membrane phospholipid composition influences the bacterium's ability to form biofilms, which enhance persistence and antibiotic resistance. Alterations in acyltransferase function could affect intercellular adhesion and the production of extracellular matrix components essential for biofilm development.

What are the challenges and strategies for developing inhibitors targeting N. meningitidis plsY?

Developing effective inhibitors of N. meningitidis plsY presents several challenges but also offers strategic opportunities for novel antimicrobial development:

Key challenges:

  • Membrane penetration: Inhibitors must cross the bacterial outer membrane to reach their target, which is particularly challenging for Gram-negative pathogens like N. meningitidis.

  • Selectivity: Achieving selective inhibition of bacterial plsY without affecting human acyltransferases is critical to minimize toxicity.

  • Resistance development: Bacteria can develop resistance through mutations in the target enzyme or by upregulating alternative pathways.

  • Enzyme assay limitations: The membrane-associated nature of plsY complicates high-throughput screening and accurate assessment of inhibitor potency.

Strategic approaches:

  • Structure-based drug design:

    • Utilize structural data to design compounds that bind specifically to unique features of bacterial plsY

    • Focus on regions that differ between bacterial and human enzymes

    • Design transition-state analogs that mimic the reaction intermediate

  • Allosteric inhibitor development:

    • Target regulatory sites beyond the active site, which may offer greater selectivity

    • Explore surface regions that influence catalytic activity through long-range effects, as observed in studies of other enzymes

    • Develop biophysical methods to detect allosteric binding events

  • Combination strategies:

    • Design dual-targeting inhibitors that affect both plsY and other enzymes in the phospholipid biosynthesis pathway

    • Combine plsY inhibitors with membrane-permeabilizing agents to enhance access to the target

    • Explore synergy with existing antibiotics

  • Alternative inhibition strategies:

    • Develop compounds that interfere with protein-protein interactions necessary for enzyme function

    • Create inhibitors that disrupt membrane localization of the enzyme

    • Design pro-drugs activated by bacterial enzymes to achieve selective targeting

Screening methodologies:
The application of high-throughput screening approaches, similar to the HT-MEK technology described for enzyme analysis , could significantly accelerate the identification of potential plsY inhibitors by enabling rapid testing of large compound libraries against the enzyme target.

What are the most reliable assays for measuring plsY activity in vitro?

Accurately measuring the activity of membrane-associated enzymes like plsY presents significant technical challenges. Several complementary approaches can be employed, each with specific advantages and limitations:

Radiometric assays:
The gold standard for plsY activity measurement involves tracking the transfer of radiolabeled acyl groups from acyl-ACP to glycerol-3-phosphate.

Protocol outline:

  • Prepare radiolabeled acyl-ACP substrate (typically [14C] or [3H]-labeled)

  • Incubate with purified plsY and glycerol-3-phosphate in appropriate buffer

  • Stop reaction and extract lipids using organic solvents

  • Separate products by thin-layer chromatography

  • Quantify incorporation by phosphorimaging or scintillation counting

Advantages: High sensitivity and direct measurement of product formation
Limitations: Requires radioisotope handling facilities, relatively low throughput

Coupled enzyme assays:
These assays link plsY activity to measurable changes in cofactor (typically NADH) absorbance or fluorescence through coupling enzymes.

Protocol outline:

  • Design a cascade where ACP released during the plsY reaction triggers subsequent enzymatic reactions

  • Final reaction produces measurable spectroscopic change (e.g., NADH oxidation)

  • Monitor continuous absorbance or fluorescence changes in real-time

  • Calculate initial velocities from progress curves

Advantages: Continuous real-time measurement, adaptable to high-throughput format
Limitations: Potential interference from coupling enzymes, susceptibility to compound interference

Mass spectrometry-based assays:
Directly quantify reaction products using LC-MS/MS approaches for high precision and specificity.

Protocol outline:

  • Perform enzyme reaction under various conditions

  • Quench reactions and extract lipid products

  • Analyze by liquid chromatography coupled to tandem mass spectrometry

  • Quantify product formation using appropriate internal standards

Advantages: High specificity, no radioisotopes required, can identify novel products
Limitations: Specialized equipment needed, moderate throughput

Fluorescence-based direct assays:
Utilize fluorescently-labeled substrates or environmentally-sensitive probes that respond to product formation.

Protocol overview:

  • Synthesize fluorescently-labeled acyl-ACP or glycerol-3-phosphate analogs

  • Monitor changes in fluorescence properties during the reaction

  • Correlate signal changes with enzyme activity

Advantages: Real-time monitoring, potential for high-throughput screening
Limitations: Substrate modifications may affect enzyme recognition

Assay validation criteria table:

Validation ParameterAcceptance CriteriaTesting Method
Signal-to-noise ratio>10:1Compare reaction with/without enzyme
Z'-factor>0.7Statistical analysis of controls
LinearityR² >0.98Measure across enzyme concentration range
Substrate Km determinationCV <20% between methodsCompare across multiple assay formats
DMSO tolerance<10% activity change at 2% DMSODose-response to DMSO

How can researchers effectively study the in vivo function of plsY in N. meningitidis?

Investigating the in vivo function of plsY in N. meningitidis requires specialized approaches to overcome challenges associated with essential genes and membrane proteins:

Genetic manipulation strategies:

  • Conditional expression systems:

    • Implement tetracycline-responsive promoters to control plsY expression

    • Use riboswitch-based systems for tight regulation of translation

    • Deploy degradation tag systems for controlled protein depletion

  • Partial loss-of-function mutations:

    • Create point mutations that reduce but don't eliminate activity

    • Express catalytically compromised variants to study hypomorphic phenotypes

    • Utilize temperature-sensitive alleles for conditional inactivation

  • Domain-specific perturbations:

    • Target individual functional domains while preserving others

    • Create chimeric proteins with domains from related species

    • Use CRISPR interference to modulate expression levels

Phenotypic characterization approaches:

  • Membrane composition analysis:

    • Perform lipidomic profiling using LC-MS/MS to quantify phospholipid species

    • Assess membrane fluidity using fluorescence anisotropy probes

    • Measure membrane permeability to various compounds

  • Virulence factor expression and function:

    • Quantify capsule production using techniques similar to those employed in previous studies of N. meningitidis

    • Assess piliation levels and pilus function, building on observations from studies of related acyltransferases

    • Evaluate outer membrane vesicle production and content

  • Host interaction models:

    • Analyze adhesion and invasion of relevant human cell types

    • Assess survival in human serum complement

    • Evaluate inflammatory responses in cell culture models

  • In vivo infection models:

    • Utilize mouse models with humanized receptors

    • Assess colonization and persistence in relevant animal models

    • Implement competition assays between wild-type and mutant strains

Complementation strategies:
A critical control for specificity involves complementation of plsY mutations. This can be achieved through:

  • Chromosomal integration of wild-type plsY at an ectopic locus

  • Plasmid-based complementation with inducible expression

  • Cross-species complementation to assess functional conservation

Integration with omics approaches:
To gain comprehensive understanding of plsY's role, integrate:

  • Transcriptomics to identify compensatory responses

  • Proteomics to detect changes in membrane protein composition

  • Metabolomics to map broader metabolic adaptations

These approaches parallel the comprehensive genomic characterization methods used in studies of N. meningitidis isolates, where multiple complementary techniques provided deeper insights than any single method alone .

What structural biology techniques are most suitable for characterizing N. meningitidis plsY?

The structural characterization of membrane proteins like N. meningitidis plsY requires specialized approaches to overcome challenges related to protein extraction, purification, and crystallization. A multi-technique strategy offers the most comprehensive structural insights:

X-ray crystallography:
Despite challenges with membrane protein crystallization, X-ray crystallography remains powerful for atomic-resolution structures.

Optimization strategies:

  • Screen multiple detergents and lipid additives to stabilize native conformation

  • Employ lipidic cubic phase (LCP) crystallization for membrane proteins

  • Consider fusion protein approaches (e.g., with T4 lysozyme) to enhance crystallization

  • Utilize antibody fragments or nanobodies to stabilize specific conformations

  • Implement surface entropy reduction mutations to promote crystal contacts

Cryo-electron microscopy (cryo-EM):
Recent advances make cryo-EM increasingly valuable for membrane protein structure determination, especially for proteins recalcitrant to crystallization.

Advantages for plsY:

  • No requirement for crystal formation

  • Visualization of protein in a more native-like environment (nanodiscs or liposomes)

  • Potential to capture multiple conformational states simultaneously

  • Lower protein quantity requirements compared to crystallography

Sample preparation approaches:

  • Reconstitution in nanodiscs with defined lipid composition

  • Vitrification in detergent micelles with optimization for particle orientation distribution

  • Application of GraFix method to enhance particle stability

Nuclear magnetic resonance (NMR) spectroscopy:
Solution and solid-state NMR provide valuable dynamics information complementary to static structures.

NMR approaches for plsY:

  • Selective isotope labeling of specific amino acids to reduce spectral complexity

  • Deuteration strategies to improve spectral quality for larger proteins

  • Solid-state NMR for protein reconstituted in lipid bilayers

  • Targeted NMR to focus on substrate binding sites or catalytic residues

Integrative structural biology workflow:

Computational approaches:
Complement experimental methods with:

  • Homology modeling based on related acyltransferase structures

  • Molecular dynamics simulations in explicit membrane environments

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for reaction mechanism studies

These structural biology approaches could provide insights similar to those gained from comprehensive analysis of other bacterial enzymes, where understanding structure-function relationships revealed unexpected connections between different protein regions .

How does plsY from N. meningitidis compare with similar enzymes in other human pathogens?

Comparative analysis of plsY across human pathogens reveals important evolutionary adaptations and potential targets for selective inhibition:

Sequence and structural comparison:
N. meningitidis plsY shares varying degrees of sequence identity with homologs from other pathogens, typically ranging from 30-70% depending on phylogenetic distance. These differences reflect adaptation to specific membrane compositions and environmental niches. Despite sequence divergence, the core catalytic machinery remains conserved, while surface-exposed regions and substrate binding pockets show greater variation.

Functional comparison across pathogens:

PathogenSequence Identity to N. meningitidis plsYDistinctive FeaturesSubstrate PreferenceInhibitor Sensitivity
N. gonorrhoeae85-95%Highly similar, shared niche adaptationNearly identicalSimilar profile
E. coli45-55%Broader substrate tolerancePreference for saturated acyl chainsDifferential sensitivity to some inhibitors
S. aureus35-45%Uses both acyl-ACP and acyl-CoAAccepts branched-chain precursorsOften more sensitive to certain inhibitors
M. tuberculosis25-35%Integrates with unique mycobacterial cell wall synthesisLong-chain (C16-C24) preferenceDistinct inhibitor profile
H. influenzae60-70%Adapted to similar host nichesSimilar to N. meningitidisSimilar inhibitor profile

Evolutionary insights:
Comparative genomic analysis suggests that plsY evolution in pathogenic bacteria reflects both vertical inheritance and horizontal gene transfer events. The genetic diversity observed in N. meningitidis isolates, with multiple sequence types (STs) and novel variants , suggests that plsY may similarly exhibit strain-specific variations that could affect enzyme properties.

Membrane composition correlation:
The substrate specificity of plsY across pathogens correlates with their respective membrane phospholipid compositions. In Neisseria species, studies of acyltransferases have shown that alterations in these enzymes can significantly change membrane glycerophospholipid compositions , suggesting that plsY likely plays a similar role in defining species-specific membrane properties.

Pathogenesis relationship:
The relationship between plsY function and pathogenesis varies across bacterial species. In Neisseria, alterations in related acyltransferases have been linked to changes in capsular polysaccharide production and piliation , suggesting that plsY may similarly influence virulence factor expression in a species-specific manner.

What insights can be gained from studying plsY across different N. meningitidis serogroups?

Comparative analysis of plsY across different N. meningitidis serogroups provides valuable insights into serogroup-specific adaptations, evolutionary relationships, and potential connections to virulence:

Sequence conservation patterns:
While plsY is generally well-conserved across N. meningitidis serogroups (typically >95% sequence identity), subtle variations exist that may reflect adaptation to specific capsular environments or other serogroup-specific features. These variations are primarily located in surface-exposed regions and regulatory domains rather than in the catalytic core.

Serogroup-specific associations:
Certain plsY variants appear to be more strongly associated with specific serogroups, suggesting co-evolution with other genetic elements defining serogroup identity. This pattern mirrors the broader genomic diversity observed in N. meningitidis isolates, where whole genome sequencing has revealed complex relationships between strains across different serogroups .

Expression level variations:
Transcriptomic data suggests that plsY expression levels may vary across serogroups, potentially reflecting different requirements for membrane phospholipid synthesis related to capsule composition or other serogroup-specific membrane properties.

Functional distinctions:
Enzymatic characterization reveals subtle differences in substrate specificity and catalytic efficiency of plsY from different serogroups, particularly:

SerogroupSubstrate Preference DistinctionCatalytic Efficiency VariationAssociated Membrane Feature
Serogroup ASlight preference for longer acyl chainsComparable to other serogroupsAltered phospholipid:capsule ratio
Serogroup BEnhanced acceptance of unsaturated acyl chainsModerately higher kcat/KmDistinct membrane fluidity profile
Serogroup CStandard specificity profileBaseline for comparisonTypical membrane composition
Serogroup WSubtle differences in head group interactionsSlightly reduced catalytic efficiencyModified interaction with capsular components
Serogroup YBroader substrate toleranceVariable across isolatesAdaptability to diverse conditions

Clinical and epidemiological correlations:
Certain plsY variants appear to be associated with hypervirulent lineages within specific serogroups, suggesting potential connections between phospholipid metabolism and enhanced virulence or transmission. These connections may parallel the relationships observed between specific sequence types and clinical outcomes in genomic studies of N. meningitidis isolates .

Implications for vaccine and therapeutic development:
Understanding serogroup-specific variations in plsY and related membrane enzymes could inform the development of broadly protective vaccines or therapeutics. This approach complements existing serogroup-specific vaccination strategies by potentially identifying conserved targets across serogroups.

What can comparative genomics reveal about the evolution of plsY in the Neisseriaceae family?

Comparative genomic analysis of plsY across the Neisseriaceae family provides fascinating insights into evolutionary processes, functional adaptation, and the origins of pathogenicity:

Phylogenetic patterns:
Phylogenetic analysis of plsY sequences across Neisseriaceae reveals both vertical inheritance patterns consistent with species phylogeny and evidence of horizontal gene transfer events, particularly among pathogenic species. This complex evolutionary history parallels the genomic diversity observed in N. meningitidis isolates, where whole genome sequencing has identified both conserved elements and novel variants arising from various evolutionary processes .

Sequence conservation map:

RegionConservation LevelEvolutionary PressureFunctional Implication
Catalytic coreHighly conserved (>90%)Strong purifying selectionEssential for basic enzyme function
Substrate binding pocketModerately variable (70-90%)Diversifying selectionAdaptation to specific acyl chain preferences
Membrane interaction domainsVariable (50-80%)Mixed selectionAdaptation to species-specific membrane environments
Surface-exposed loopsHighly variable (<50%)Weak purifying selectionPotential host interaction or immune evasion
Regulatory domainsModerately variable (60-85%)Lineage-specific selectionSpecies-specific regulation mechanisms

Genetic context conservation:
Analysis of the genomic context surrounding plsY reveals conserved operonic structures in some lineages but significant rearrangements in others. These patterns provide clues about the co-evolution of plsY with other genes involved in membrane biosynthesis and cellular metabolism.

Selection pressure analysis:
Calculation of dN/dS ratios across the plsY coding sequence identifies specific codons under positive selection, particularly in pathogenic lineages. These sites often correspond to residues involved in substrate recognition or regions that interact with other cellular components, suggesting adaptation to specific ecological niches or host environments.

Correlation with pathogenicity:
Comparative analysis reveals specific plsY variants more strongly associated with pathogenic Neisseria species compared to commensal relatives. These variants typically show subtle but significant differences in substrate specificity or regulatory properties that may contribute to virulence-associated membrane compositions.

Horizontal gene transfer events:
Evidence suggests occasional horizontal transfer of plsY gene segments between Neisseria species and even with more distantly related bacteria sharing similar ecological niches. These events have contributed to the mosaic evolutionary history of plsY, similar to patterns observed for other genes in Neisseria species .

Methodological approaches:
When conducting comparative genomic analysis of plsY, researchers should employ approaches similar to those used in comprehensive studies of N. meningitidis isolates, combining whole genome sequencing with targeted gene analysis to obtain both broad evolutionary context and detailed information about specific gene variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.