Recombinant Neisseria meningitidis serogroup C Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Function

Lgt catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue within the lipobox of preprolipoproteins, a process essential for their maturation and membrane localization . This modification enables downstream cleavage by lipoprotein signal peptidase (LspA) and subsequent triacylation by apolipoprotein N-acyltransferase (Lnt), critical steps for outer membrane anchoring of virulence factors like Factor H-binding protein (FHbp) .

Key biological roles:

  • Facilitates Sec-dependent translocation of lipoproteins across the inner membrane .

  • Required for surface expression of FHbp, a major vaccine antigen .

  • Influences lipooligosaccharide (LOS) biosynthesis and immune evasion .

Genetic Diversity and Pathogenicity

  • Capsule synthesis linkage: The lgt gene cluster (lgtZCDH) in serogroup C strains differs from non-pathogenic Neisseria species (e.g., N. polysaccharea), correlating with LOS immunotype L1/L8 expression .

  • PCR-based identification: lgtZ, lgtC, lgtD, and lgtH are conserved in serogroup C meningococci but absent in non-encapsulated variants .

Role in Immune Evasion

  • LOS biosynthesis: Lgt-mediated lipid modification enables:

    • Resistance to complement-mediated lysis .

    • Molecular mimicry of human neural cell adhesion molecules (L1 immunotype) .

  • Vaccine antigen processing: Mutations in Lgt’s signal peptide reduce FHbp surface exposure, impairing antibody responses .

Vaccine Antigen Engineering

  • FHbp surface localization: Lgt-processed FHbp is a key component of MenB vaccines (e.g., Bexsero®) .

  • Strain-specific challenges: Non-functional Lgt variants (e.g., frameshift mutations) in 8% of invasive serogroup C isolates reduce FHbp immunogenicity .

Therapeutic Targeting

  • Antimicrobial design: Inhibitors of Lgt’s diacylglyceryl transferase activity could disrupt lipoprotein maturation .

  • Diagnostic applications: Recombinant Lgt serves as an ELISA antigen for serotyping .

Research Gaps and Future Directions

  • Structural dynamics: No crystallographic data exist for meningococcal Lgt; homology models are based on E. coli Lgt .

  • Cross-serogroup variability: Limited data on Lgt functional differences between serogroups C and B .

  • Clinical correlations: Impact of lgt polymorphisms on vaccine efficacy remains uncharacterized .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; NMCC_0990; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C (strain 053442)
Target Names
lgt
Target Protein Sequence
MIIHPQFDPVLISIGPLAVRWYALSYILGFILFTFLGRRRIAQGLSVFTKESLDDFLTWG ILGVIFGGRLGYVLFYKFSDYLAHPLDIFKVWEGGMSFHGGFLGVVIAIWLFGRKHGIGF LKLMDTVAPLVPLGLASGRIGNFINGELWGRVTDINAFWAMGFPQARYEDLEAAAHNPLW AEWLQQYGMLPRHPSQLYQFALEGICLFAVVWLFSKKQRPTGQVASLFLGGYGIFRFIAE FARQPDDYLGLLTLGLSMGQWLSVPMIVLGIVGFVRFGMKKQH
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in N. meningitidis?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification of bacterial lipoproteins. In N. meningitidis, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins. This modification is essential for anchoring lipoproteins to the bacterial membrane, which is critical for maintaining cell envelope integrity, nutrient uptake, transportation, adhesion, invasion, and other virulence functions. The deletion of the lgt gene is lethal to most Gram-negative bacteria, including N. meningitidis, highlighting its fundamental role in bacterial viability .

How does N. meningitidis serogroup C differ from other serogroups regarding Lgt?

While the core function of Lgt remains consistent across all N. meningitidis serogroups, genetic analyses have revealed significant variation in lgt loci organization between different strains. N. meningitidis demonstrates hypervariable genomic regions at lgt-1 and lgt-3 loci, while the lgt-2 locus remains relatively conserved. This genetic diversity contributes to variations in lipooligosaccharide (LOS) structures, which are major virulence factors in pathogenic Neisseria. The specific characteristics of serogroup C strains include distinct patterns of lgt gene arrangement that can influence membrane composition and pathogenicity profiles, though the functional domains of Lgt itself remain highly conserved due to evolutionary constraints .

What are the common methods for expressing recombinant N. meningitidis Lgt in laboratory settings?

Recombinant expression of N. meningitidis Lgt typically involves cloning the lgt gene into expression vectors suitable for membrane protein production. The most successful approaches include:

  • E. coli-based expression systems: Using BL21(DE3) strains with pET vectors containing solubility-enhancing fusion tags (MBP, SUMO)

  • Controlled expression conditions: Induction at reduced temperatures (16-20°C) to improve proper folding

  • Membrane extraction protocols: Utilizing mild detergents (DDM, LDAO) for extraction while maintaining protein structure

  • Purification strategies: Employing affinity chromatography followed by size exclusion chromatography

The expression system must account for the challenges of producing integral membrane proteins while maintaining enzymatic activity. Complementation studies in lgt knockout strains can verify functionality of the recombinant protein. Variants with mutations in key residues (Y26, H103, R143, N146, G154, and R239) typically fail to restore growth in lgt-deficient strains, confirming these amino acids are essential for enzyme function .

What structural features determine Lgt substrate specificity in N. meningitidis?

The substrate specificity of N. meningitidis Lgt is determined by distinct structural domains that have evolved for recognition of both lipid and protein substrates. Based on structural analyses of related bacterial Lgt proteins:

  • Arm domains: These recognize and interact with phosphatidylglycerol, positioning the substrate for catalysis

  • Head domain: Contains variable regions that recognize specific features of prolipoproteins

  • Conserved N-terminal region: Maintains core catalytic function across Neisseria species

  • Variable C-terminal region: Contributes to acceptor specificity

Protein sequence comparisons between LgtB, LgtE, and LgtH enzymes show a conserved N-terminal region alongside a highly variable C-terminal region, suggesting functional constraint for substrate specificity in the N-terminus and acceptor specificity in the C-terminus . The orientation of the enzyme within the membrane facilitates lateral substrate entry and product exit relative to the lipid bilayer, essential for the diacylglyceryl transfer mechanism .

How do mutations in key residues affect Lgt function and bacterial viability?

Mutational studies have identified several critical residues essential for Lgt function in related bacterial systems. Recent complementation experiments with E. coli lgt variants have provided detailed insights into residue functionality:

Residue MutationGrowth EffectFunctional ImpactProposed Role
D129A, E243AViable, normal growthMinimal impactNon-essential for catalysis
G98A, G104A, E151AViable, delayed growthModerate impactSupporting structural role
Y26A, R143A, N146ANon-viableCritical impactEssential for substrate binding
G154A, R239ANon-viableCritical impactEssential for catalysis
H103QGrowth to mid-exponential phase followed by lysisCritical impactEssential for catalytic activity

Specifically, mutations in Y26, H103, R143, N146, G154, and R239 are lethal, highlighting their essential roles in the catalytic mechanism. The H103Q variant shows an interesting phenotype where cells grow initially but then lyse, suggesting partial activity that ultimately fails to maintain membrane integrity . These residues likely form part of the active site or are involved in substrate recognition and binding.

What is the relationship between Lgt structure and lipooligosaccharide (LOS) biosynthesis in pathogenic Neisseria?

While Lgt itself is not directly involved in LOS biosynthesis, both pathways are critical for membrane structure and pathogenesis in N. meningitidis. The lgt gene operates in the lipoprotein processing pathway, while LOS biosynthesis involves separate glycosyltransferase genes (lgtB, lgtE, lgtH). These pathways intersect at the level of membrane organization and virulence:

  • Membrane organization: Properly processed lipoproteins contribute to membrane structure where LOS is anchored

  • Virulence factor expression: Both pathways contribute to different aspects of pathogen-host interaction

  • Evolutionary patterns: Both gene families show evidence of horizontal gene transfer and selective pressure

The lgtH gene specifically encodes a β-1,4-galactosyltransferase essential for LOS biosynthesis, with glucose moiety linked to heptose in the alpha chain serving as the acceptor site. Comparative analyses of 23 lgtB, 12 lgtE, and 14 lgtH sequences reveal distinct evolutionary histories of these genes in Neisseria, with lgtE displaying network evolution through frequent DNA recombination while lgtB and lgtH show star-tree-like evolution through point mutations .

What are the most effective methods for purifying active recombinant N. meningitidis Lgt?

Purification of active recombinant N. meningitidis Lgt presents significant challenges due to its integral membrane nature. The most successful purification strategies employ:

  • Detergent screening: Systematic testing of detergents (typically n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol) to identify optimal solubilization conditions

  • Two-phase purification protocol:

    • Initial purification via immobilized metal affinity chromatography (IMAC)

    • Secondary purification via size exclusion chromatography to remove aggregates

  • Stability optimization: Addition of phospholipids during purification to maintain the enzyme in a native-like lipid environment

  • Activity preservation: Including glycerol (10-15%) and reducing agents to prevent oxidation of critical cysteine residues

The purified enzyme can be validated through in vitro activity assays measuring the transfer of diacylglyceryl moiety from phosphatidylglycerol to synthetic peptide substrates containing the lipobox motif. Structural integrity can be assessed through circular dichroism spectroscopy to confirm proper folding of the membrane protein .

How can researchers determine the specific activity and kinetic parameters of recombinant Lgt?

Determining the enzymatic activity and kinetic parameters of recombinant N. meningitidis Lgt requires specialized assays that accommodate its membrane protein nature:

  • GFP-based in vitro assay: Using GFP-tagged lipobox-containing peptides to monitor diacylglyceryl transfer through changes in electrophoretic mobility

  • Radiolabeled substrate approach: Employing 14C or 3H-labeled phosphatidylglycerol to quantify diacylglyceryl transfer rates

  • Mass spectrometry-based assays: Detecting mass shifts in substrate peptides following lipid modification

  • Kinetic parameter determination:

    • Varying substrate concentrations to establish Km values for both phosphatidylglycerol and peptide substrates

    • Determining Vmax and kcat through initial velocity measurements under saturating substrate conditions

These assays can be correlated with structural observations to develop a comprehensive understanding of the enzyme mechanism. Comparisons between wild-type and mutant variants provide insights into how specific residues contribute to substrate binding and catalysis .

What genetic approaches are most informative for studying Lgt function in N. meningitidis?

Several genetic approaches have proven valuable for investigating Lgt function in N. meningitidis:

  • Gene knockout and complementation: Though direct lgt knockouts are typically lethal, conditional knockout systems using inducible promoters allow for controlled expression

  • Site-directed mutagenesis: Systematic mutation of conserved residues to identify those critical for function

  • Domain swapping experiments: Exchanging domains between Lgt proteins from different Neisseria species to determine specificity determinants

  • GFP fusion reporters: Monitoring localization and expression under different conditions

  • Transcriptional analysis: RNA-seq and qPCR to examine expression patterns and regulatory networks

Complementation experiments in lgt-knockout cells with different Lgt variants have been particularly informative, revealing that residues Y26, H103, R143, N146, G154, and R239 are essential for function. The variable growth patterns of different mutants (from normal growth to complete growth arrest and cell lysis) provide insights into the relative importance of different protein regions .

How does the lgt gene vary across different Neisseria species and what implications does this have for research?

The lgt gene shows significant variation across Neisseria species, reflecting diverse evolutionary pressures:

  • Species-specific patterns:

    • N. meningitidis: Hypervariable lgt-1 and lgt-3 loci, conserved lgt-2 locus

    • N. gonorrhoeae: Stable composition and organization across all three lgt loci

    • Commensal Neisseria: Variable presence of lgt genes, found only in some species

  • Genetic organization diversity:

    • Eight distinct types of organization at the lgt-1 locus

    • Four types of arrangement at the lgt-3 locus

    • Novel genetic organizations continuing to be discovered

  • Research implications:

    • Strain selection is critical when studying N. meningitidis Lgt

    • Results from one strain may not be generalizable to all N. meningitidis strains

    • Comparative studies across multiple strains provide more comprehensive insights

This diversity stems from horizontal gene transfer between pathogenic and commensal Neisseria species, which share a common lgt gene pool. These genetic exchange events have contributed to the emergence of distinct LOS genotypes, with at least 10 identifiable in N. meningitidis .

What evidence exists for horizontal gene transfer affecting lgt genes in Neisseria?

Multiple lines of evidence support horizontal gene transfer (HGT) as a significant factor in lgt gene evolution:

  • Phylogenetic incongruence: Gene trees for lgt genes often differ from species phylogeny, suggesting independent evolutionary histories

  • Mosaic gene structures: Many lgt genes show segments with different evolutionary origins

  • Shared gene pools: Pathogenic and commensal Neisseria species contain highly similar lgt genes despite distant phylogenetic relationships

  • Distribution patterns: The irregular distribution of specific lgt genes across Neisseria species suggests acquisition rather than vertical inheritance

  • Sequence similarity clustering: lgtH clusters separately from homologous genes lgtB and lgtE, despite functional similarities

The mutual exclusivity of lgtH and lgtE genes at the same position in lgt-1 further suggests gene displacement through HGT events. These patterns of genetic exchange likely contribute to the diversification of surface structures that help pathogenic Neisseria evade host immune responses and adapt to different host environments .

How do evolutionary patterns differ between lgtB, lgtE, and lgtH genes in Neisseria meningitidis?

The lgtB, lgtE, and lgtH genes in N. meningitidis display distinct evolutionary patterns:

GeneEvolutionary PatternMolecular MechanismFunctional Implication
lgtBStar-tree-like evolutionAccumulation of point mutationsGradual functional refinement
lgtENetwork evolutionFrequent DNA recombinationRapid functional diversification
lgtHStar-tree-like evolutionAccumulation of point mutationsGradual functional refinement

These differences reflect varying selective pressures on each gene. The conserved N-terminal regions of these enzymes suggest functional constraints for substrate specificity, while the highly variable C-terminal regions likely determine acceptor specificity. This pattern of molecular evolution has resulted in multiple enzyme isoforms capable of generating diverse oligosaccharide structures, allowing N. meningitidis to adapt to different host environments and immune pressures .

How does Lgt activity contribute to N. meningitidis virulence and pathogenesis?

Lgt activity is fundamental to N. meningitidis virulence through multiple mechanisms:

  • Lipoprotein processing: By catalyzing the first step in lipoprotein maturation, Lgt ensures proper localization and function of numerous virulence-associated lipoproteins

  • Membrane integrity: Properly processed lipoproteins maintain cell envelope architecture, essential for survival during infection

  • Host interaction: Lipoproteins processed by Lgt mediate adhesion to host cells, nutrient acquisition, and immune evasion

  • Stress resistance: Functional lipoproteins contribute to resistance against antimicrobial peptides, oxidative stress, and pH changes encountered during infection

  • Immune modulation: Lipoproteins can trigger TLR2-mediated responses, potentially modulating host immunity to favor bacterial survival

What is the relationship between Lgt and lipooligosaccharide (LOS) in N. meningitidis virulence?

While Lgt and LOS biosynthesis involve distinct genetic pathways, their combined effects significantly influence N. meningitidis virulence:

  • Complementary virulence roles:

    • Lgt processes lipoproteins that maintain membrane structure and function

    • LOS (produced by lgtB, lgtE, lgtH) provides endotoxin activity and molecular mimicry

  • Structural cooperation:

    • Properly processed lipoproteins may influence LOS presentation on the cell surface

    • Both contribute to outer membrane vesicle formation, important for distant host cell effects

  • Combined immune evasion:

    • Lipoproteins can modulate immune responses

    • LOS variation (through phase variation of lgt genes) helps evade adaptive immunity

The function of lgtH as a β-1,4-galactosyltransferase is particularly significant, as it adds galactose to the glucose moiety linked to heptose in the alpha chain, a critical step in LOS biosynthesis. Mutations in this pathway result in truncated LOS structures with reduced virulence potential .

How do arm and head domains in Lgt determine functional diversity among bacterial pathogens?

Recent research has identified that arm and head domains in the highly conserved Lgt enzyme contribute significantly to functional diversity among bacterial pathogens:

  • Arm domains:

    • Function in substrate recognition and binding

    • Structural variations influence phospholipid preferences

    • Evolutionary adaptations match membrane composition of specific pathogens

  • Head domain:

    • Contains the catalytic site for diacylglyceryl transfer

    • Variations affect substrate specificity for different prolipoprotein sequences

    • Species-specific adaptations fine-tune activity for optimal function in different bacterial contexts

  • Domain interactions:

    • Coordinated movements between domains facilitate substrate entry and product release

    • Species-specific variations in domain interactions affect catalytic efficiency

This structural and functional diversity allows Lgt to operate effectively in different bacterial membrane environments, contributing to the pathogenic potential of various species including N. meningitidis. Understanding these domain-specific functions provides opportunities for developing species-selective inhibitors that could disrupt pathogen-specific Lgt activity .

What are the most promising approaches for developing inhibitors against N. meningitidis Lgt?

Developing inhibitors against N. meningitidis Lgt presents both challenges and opportunities for antimicrobial development:

  • Structure-based design approaches:

    • Virtual screening against crystal structure models based on E. coli Lgt homology

    • Fragment-based drug discovery targeting the active site

    • Molecular dynamics simulations to identify transient binding pockets

  • Substrate analog development:

    • Phosphatidylglycerol analogs that compete for binding

    • Peptide inhibitors mimicking the lipobox motif

    • Transition state analogs that bind with higher affinity than substrates

  • Species-selective targeting:

    • Focusing on less conserved regions of the enzyme

    • Exploiting structural differences in the substrate binding pocket

    • Developing allosteric inhibitors targeting N. meningitidis-specific regulatory sites

  • High-throughput screening optimization:

    • Development of cell-based reporter assays for Lgt inhibition

    • Adaptation of in vitro activity assays for screening compound libraries

    • Counterscreening against human enzymes to ensure selectivity

The identification of essential residues like Y26, H103, R143, N146, G154, and R239 provides specific molecular targets for rational inhibitor design. Compounds that interfere with these residues' functions have high potential as novel antibacterial agents .

How can researchers address contradictions in the literature regarding Lgt function and structure?

Researchers investigating N. meningitidis Lgt frequently encounter contradictory findings in the literature, which can be addressed through several methodological approaches:

  • Standardization of experimental systems:

    • Using consistent expression systems and purification protocols

    • Clearly defining the genetic background of N. meningitidis strains used

    • Employing standardized activity assay conditions

  • Comprehensive characterization:

    • Combining structural, biochemical, and genetic approaches

    • Validating findings across multiple strains to account for genetic diversity

    • Using complementary techniques to confirm key observations

  • Resolving strain-specific differences:

    • Systematic comparison of Lgt function across different N. meningitidis isolates

    • Correlating genetic variations with functional differences

    • Developing strain-typing systems based on lgt genetic organization

  • Addressing methodological limitations:

    • Critical evaluation of in vitro versus in vivo findings

    • Considering the impact of membrane environment on enzyme function

    • Developing new methodologies to study membrane proteins in near-native conditions

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more comprehensive understanding of Lgt structure and function across different Neisseria species and strains .

What are the most significant unresolved questions regarding N. meningitidis Lgt that warrant further investigation?

Despite significant advances, several critical questions about N. meningitidis Lgt remain unresolved:

  • Detailed catalytic mechanism:

    • How does proton transfer occur during the reaction?

    • What is the precise order of substrate binding and product release?

    • How do membrane dynamics influence catalytic efficiency?

  • Regulatory mechanisms:

    • How is Lgt expression regulated during infection?

    • Are there post-translational modifications that modulate Lgt activity?

    • Does Lgt activity respond to environmental stress conditions?

  • Substrate specificity determinants:

    • What molecular features beyond the lipobox determine substrate recognition?

    • How does Lgt discriminate between proper substrates and other membrane proteins?

    • Can substrate specificity be engineered for biotechnological applications?

  • Evolutionary implications:

    • How has horizontal gene transfer shaped Lgt function across Neisseria species?

    • What selective pressures drive Lgt evolution in pathogenic versus commensal Neisseria?

    • Are there strain-specific adaptations in Lgt that correlate with virulence potential?

  • Therapeutic targeting:

    • Can species-specific inhibitors be developed that target N. meningitidis Lgt?

    • What is the potential for resistance development against Lgt inhibitors?

    • Could Lgt-processed lipoproteins serve as vaccine candidates?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.