Recombinant Neisseria meningitidis serogroup C Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

3.1. Vaccine Development

Though not directly tested as a vaccine candidate in the provided studies, CrcB’s surface localization and conserved structure across Neisseria species make it a potential target. Comparative immunoproteomic studies in related pathogens (e.g., Neisseria gonorrhoeae) highlight the importance of outer membrane proteins (OMPs) in generating immune responses .

3.2. Mechanistic Studies

Recombinant CrcB enables:

  • Binding assays to identify fluoride transport inhibitors.

  • Structural studies (e.g., X-ray crystallography) to resolve ion channel architecture.

Production and Quality Control

The protein is produced via recombinant DNA technology, with protocols emphasizing:

  • Affinity chromatography using His-tag purification .

  • Lyophilization for long-term stability, requiring reconstitution in deionized water or glycerol-containing buffers .

  • Avoidance of repeated freeze-thaw cycles to prevent aggregation .

Research Gaps and Future Directions

While recombinant CrcB is biochemically well-characterized, its pathogenic role in N. meningitidis remains underexplored. Key unanswered questions include:

  • Interaction with host cells during infection.

  • Contribution to virulence or antibiotic resistance.

  • Utility in multi-component vaccines alongside established antigens (e.g., TbpA/B) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; NMCC_0983; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C (strain 053442)
Target Names
crcB
Target Protein Sequence
MLSNIIPLSIGAALGATARWLLNLAVPAAMSPATGNLFANWTGALLIGIFAETVNHPQWK LLLITGFLGSLTTLSGFSLETVTLLQSNRPASALSNIFLHTAGSLLLTWLGLKIGTAVK
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the major antigenic proteins identified in N. meningitidis and how do they compare structurally to CrcB homologs?

The major antigenic proteins identified in N. meningitidis include NHBA (Neisserial Heparin Binding Antigen), NadA (Neisseria meningitidis adhesin A), fHbp (factor H-binding protein), PilC1 (a pilus-associated protein), and TbpA/TbpB (Transferrin Binding Proteins). While specific structural comparisons to CrcB homologs are not directly addressed in current literature, these proteins share common features of bacterial membrane-associated proteins that could inform CrcB research approaches .

For recombinant expression studies, researchers should note that NHBA contains an arginine-rich region critical for binding function, demonstrating how specific motifs can determine protein functionality—a consideration potentially relevant when studying CrcB homologs .

How does N. meningitidis gene expression change upon contact with host cells, and could similar mechanisms regulate crcB expression?

N. meningitidis possesses sophisticated contact-regulated gene expression systems. Key genes like pilC1 and crgA are regulated through a promoter element called CREN (contact regulatory element of Neisseria) that induces expression upon contact with host cells. CrgA functions as a LysR-type transcriptional regulator whose expression increases upon cell contact .

Experimental evidence shows that crgA expression is significantly upregulated when bacteria interact with epithelial cells, with transcription primarily occurring from the P2 promoter site within the CREN region . This contact-dependent regulation represents a potential model for investigating whether crcB expression might be similarly regulated by host cell interactions.

What functional characteristics define N. meningitidis surface proteins, and how might these relate to CrcB homolog studies?

N. meningitidis surface proteins typically demonstrate multiple functional characteristics that could inform CrcB homolog research:

  • Host cell adhesion - NHBA contributes significantly to epithelial cell binding, with mutation studies showing that alterations in the Arg-rich tract abrogate this binding capacity

  • Immune evasion - Proteins like fHbp bind host complement regulators

  • Nutrient acquisition - TbpA and TbpB bind human transferrin for iron acquisition

  • Transcriptional regulation - CrgA regulates other genes upon cell contact

Researchers studying CrcB homologs should consider these functional categories when designing characterization experiments.

What expression systems and constructs are most effective for recombinant N. meningitidis protein production?

E. coli represents the most widely validated expression system for recombinant N. meningitidis proteins. Specific strategies that have proven successful include:

  • Vector selection: The CAMR pMTL vector series has been successfully used (pMTL2000 for tbpA, pMTL2010 for tbpB)

  • Fusion constructs: Creating fusion proteins can improve expression and functionality, as demonstrated with NHBA-GNA1030 and GNA2091-fHbp fusions in the 4CMenB vaccine

  • Signal sequence optimization: Utilizing bacterial signal sequences like rlpB joined to the mature protein sequence can improve membrane protein expression

For optimal cloning, researchers have successfully employed PCR amplification of target genes using primers containing specific restriction sites (such as NdeI at the start codon and BamHI after the stop codon) followed by cloning into appropriate expression vectors .

What purification strategies yield high-quality recombinant N. meningitidis proteins suitable for functional studies?

For recombinant N. meningitidis proteins, affinity chromatography approaches have proven most effective. Researchers have demonstrated that recombinant proteins like TbpA and TbpB retain their binding functionality, allowing purification through affinity to their natural ligand (human transferrin) . This functional purification approach could be adapted for CrcB homologs if their binding partners are known.

For protein quality assessment, Western blotting analysis comparing recombinant proteins to native versions expressed in N. meningitidis strains provides critical validation of structural integrity .

What cellular assays effectively evaluate recombinant N. meningitidis protein functionality?

Several cellular assays have been validated for N. meningitidis proteins:

  • Adhesion assays: Quantifying bacteria-cell interactions using wild-type and knockout strains

    • Example data: MC58 wild-type strains showed significantly higher adhesion to Hec-1B cells compared to nhba knockout mutants, with complemented strains restoring adhesion capacity

  • Binding assays: Direct measurement of recombinant protein binding to cells

    • NHBA protein binding to epithelial cells was demonstrated, with mutations in the Arg-rich region abolishing this interaction

  • Cell contact-dependent gene expression:

    • Primer extension analysis comparing bacteria harvested from infected epithelial cell monolayers versus bacteria grown in cell culture media demonstrates induction of specific genes

What in vivo models are suitable for evaluating recombinant N. meningitidis protein immunogenicity?

The mouse intraperitoneal-infection model has been validated for evaluating protective efficacy of recombinant N. meningitidis proteins. Key findings from this model include:

  • TbpA affords protection against meningococcal challenge when administered as the sole immunogen

  • TbpA-mediated protection extends to heterologous strains (including serogroup C isolates)

  • TbpB provides significant protection but with more strain specificity than TbpA

  • Combining TbpA and TbpB can potentially enhance cross-strain protection

This model provides valuable insights into how recombinant CrcB homologs might be evaluated for protective capacity.

How can protein microarray technology be applied to study immune responses to N. meningitidis proteins?

Protein microarray technology provides a powerful platform for studying the immune response to N. meningitidis proteins with minimal sample volume requirements. Researchers have developed ad hoc protein microarrays to study immune responses to 4CMenB vaccine antigens in vaccinated individuals, allowing high-throughput epitope mapping .

This approach enables:

  • Identification of specific human antibody repertoires correlating with bactericidal responses

  • Comparison of immune responses across different age groups

  • Detection of protective signatures that could inform vaccine design

  • Evaluation of cross-protection potential against non-B meningococcal strains and N. gonorrhoeae

These methodologies could be applied to study immune responses to recombinant CrcB homologs in future research.

What experimental approaches can resolve contradictory findings regarding N. meningitidis protein function?

When contradictory findings arise in N. meningitidis protein research, several validated experimental approaches can help resolve discrepancies:

  • Complementation studies: Reintroducing wild-type genes into knockout mutants to confirm phenotype restoration

    • Example: MC58Δnhba complemented with wild-type nhba (MC58::nhba) restored adhesion properties to levels comparable with wild-type strains

  • Multiple cellular models: Testing protein function across different cell types

    • Example: NHBA adhesion properties were validated in both Hec-1B and polarized Calu-3 epithelial cells

  • Combined in vitro and in vivo approaches: Comparing bactericidal antibody responses (in vitro) with protection in mouse models (in vivo)

    • TbpB elicits stronger bactericidal antibody responses while TbpA provides broader cross-strain protection, demonstrating how different assays reveal complementary aspects of protection

How can researchers effectively study the synergistic effects between multiple N. meningitidis proteins?

Understanding synergistic effects between multiple N. meningitidis proteins is critical for comprehensive research. Experimental evidence demonstrates that antibodies directed against fHbp, NadA, and NHBA can induce bactericidal killing in a cooperative manner .

Methodological approaches to investigate such synergies include:

  • Combination immunization studies comparing individual versus combined antigens

  • Serum bactericidal assays testing antibodies against individual proteins versus combinations

  • Analysis of antibody repertoires using protein microarrays to identify epitope-specific responses

  • Cooperative binding assays to determine if proteins function independently or cooperatively

The 4CMenB vaccine development represents a successful application of this approach, where multiple antigens work synergistically to provide broader protection than individual components .

What molecular methods enable efficient detection and characterization of N. meningitidis genes encoding membrane proteins?

Researchers have developed multiplex PCR assays for N. meningitidis detection and genogrouping that could be adapted for specific gene detection. These assays:

  • Utilize primers specific for N. meningitidis species and individual serogroups

  • Achieve detection sensitivity of 1 ng genomic DNA (approximately 4 × 10^5 genomes)

  • Detect approximately 3 × 10^5 CFU/ml in non-cultured mock CSF specimens

  • Demonstrate specificity against closely related species

For genetic characterization of membrane proteins, researchers have successfully employed:

  • PCR amplification with Hi-Fidelity Taq DNA Polymerase

  • TA Cloning systems for initial cloning steps

  • Restriction enzyme-based subcloning into expression vectors

How does sequence variation in N. meningitidis proteins affect cross-strain functionality and protection?

Sequence variation significantly impacts both functionality and cross-protection potential. Key findings include:

  • Heterogeneity of TbpB represents a potential obstacle to protection against diverse meningococcal strains

  • TbpA demonstrates broader cross-protection despite lower bactericidal antibody induction

  • Protein expression levels and the number of expressed antigens may differ across meningococcal strains

  • Antibodies directed against multiple epitopes on fHbp, NadA, and NHBA can provide synergistic bactericidal activity

This suggests that when studying CrcB homologs, researchers should analyze sequence conservation across strains and consider how variations might impact function and protection.

What statistical approaches are most appropriate for analyzing N. meningitidis protein binding and functionality data?

Based on published research methodologies, the following statistical approaches have proven effective:

  • ANOVA testing for comparing multiple experimental conditions in adhesion assays

    • Example: Statistical significance in adhesion differences between wild-type, knockout, and complemented strains was determined using ANOVA, with p-values < 0.05 considered significant

  • Fold-difference calculations for expressing relative changes in binding capacity

    • Wild-type and knockout strain comparisons are frequently reported as fold differences in adhesion

  • Percentage of wild-type activity for normalization across experiments

    • Results reported as percentage of CFU counts with respect to wild-type strain (set as 100%)

What considerations are critical when designing experiments to evaluate cross-protection against different N. meningitidis strains?

When designing cross-protection studies, researchers should consider:

  • Strain selection criteria:

    • Include strains from diverse serogroups (A, B, C, W135, Y)

    • Select strains with varying protein expression levels

    • Include strains with sequence variants of target proteins

  • Protection assessment methods:

    • In vitro serum bactericidal assays

    • Mouse intraperitoneal infection models

    • Analysis of antibody binding to heterologous strains

  • Data interpretation frameworks:

    • Consider both the breadth (number of strains) and depth (degree of protection) of cross-protection

    • Evaluate correlations between sequence similarity and protection levels

    • Assess the contribution of individual epitopes to cross-protection

These approaches would be applicable to studies investigating potential cross-protection offered by recombinant CrcB homologs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.