Recombinant Neisseria meningitidis serogroup C UPF0761 membrane protein NMCC_0461 (NMCC_0461)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Neisseria meningitidis Serogroup C UPF0761 Membrane Protein NMCC_0461

Recombinant Neisseria meningitidis serogroup C UPF0761 membrane protein NMCC_0461 (UniProt ID: A9M1Y8) is a full-length transmembrane protein expressed in Escherichia coli with an N-terminal histidine (His) tag for purification purposes . This 408-amino-acid protein is derived from the meningococcal serogroup C strain and is associated with critical membrane functions, though its exact biological role in pathogenesis remains under investigation . Its recombinant form enables studies on structural dynamics, antigenicity, and interactions with host cells.

Key Features:

PropertyDetails
Source OrganismNeisseria meningitidis serogroup C (strain 053442)
Expression SystemE. coli (full-length) or cell-free system (transmembrane domain)
Molecular Weight~46 kDa (calculated based on 408 aa sequence)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for stability

Sequence Highlights:

  • Amino Acid Sequence: Begins with MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQ... and includes hydrophobic transmembrane domains .

  • Functional Motifs: Predicted α-helical regions typical of integral membrane proteins, suggesting roles in structural anchoring or transport .

Functional Insights:

  • Membrane Protein Dynamics: NMCC_0461 belongs to the UPF0761 family, which is implicated in membrane integrity and potential interactions with host cells .

  • Hydrophobic Mismatch: Computational models suggest its transmembrane helices may undergo structural adaptations (e.g., tilt or aggregation) to accommodate lipid bilayer thickness variations, a phenomenon critical for bacterial survival .

  • Pathogenicity Links: While direct evidence is limited, homologs in N. meningitidis (e.g., TbpA/B, Opc) are involved in iron uptake, adhesion, and immune evasion . NMCC_0461 may contribute to similar pathways.

Experimental Use Cases:

  1. Vaccine Development: As a surface-exposed protein, NMCC_0461 is a candidate for subunit vaccines targeting meningococcal serogroup C .

  2. Structural Biology: Used in X-ray crystallography or cryo-EM studies to resolve membrane protein architectures .

  3. Host-Pathogen Interaction Studies: Investigated for binding to human receptors (e.g., transferrin) or participation in biofilm formation .

Comparative Analysis with Other Meningococcal Proteins:

ProteinFunctionExpression SystemRelevance to NMCC_0461
TbpAIron acquisition via transferrinE. coliShared recombinant production methods
OpcAdhesion to epithelial cellsE. coliOverlapping membrane localization
BacteriorhodopsinLight-driven proton pumpHalobacteriaStructural homology in α-helical domains

Challenges and Future Directions

  • Functional Characterization: The protein’s exact role in meningococcal virulence requires further knockout studies or glycan-binding assays .

  • Optimization of Solubility: Hydrophobic regions necessitate detergent screening for stable in vitro experiments .

  • Cross-Reactivity Studies: Evaluate antigenic overlap with other serogroups (e.g., B or Y) to assess diagnostic/therapeutic potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a guideline.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you require a specific tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
NMCC_0461; UPF0761 membrane protein NMCC_0461
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Neisseria meningitidis serogroup C (strain 053442)
Target Names
NMCC_0461
Target Protein Sequence
MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFRRGFDSRGRFDDVLKILLLL DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARHGYIYSGRQGWVLKTGADSIELNEL FKLFVYRPLPVERDHVNQAVDAVMMPCLQTLNMTLAEFDAQAKKQQQS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the optimal approach for designing experiments to study NMCC_0461 function?

When designing experiments to study NMCC_0461 function, researchers should adhere to the three fundamental principles of experimental design: randomization, replication, and reduction of variance .

Randomization ensures that treatment groups are assigned in a way that minimizes systematic bias. For example, when comparing wildtype N. meningitidis with NMCC_0461 mutants, samples should be randomly allocated to different experimental conditions .

Replication is essential for statistical validity. Both biological replicates (independent bacterial cultures) and technical replicates (multiple measurements of the same sample) should be included. For membrane proteins like NMCC_0461, which can be challenging to work with, at least three biological replicates are recommended to account for variability in protein expression and purification .

Reduction of variance involves controlling experimental conditions to minimize unwanted variability. This includes standardizing protocols for protein expression, purification, and functional assays. When working with recombinant NMCC_0461, consistent expression systems and purification methods are critical for reproducible results .

What are the optimal storage and handling conditions for recombinant NMCC_0461 protein?

Recombinant NMCC_0461 protein is typically supplied as a lyophilized powder and requires specific handling for optimal stability and activity . The recommended storage protocol includes:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • The default final concentration of glycerol is typically 50%

Given that NMCC_0461 is a membrane protein, special consideration should be given to maintaining its native conformation. Addition of appropriate detergents or incorporation into lipid nanodiscs may be necessary for certain applications.

How can transcriptome analysis help understand the role of NMCC_0461 in pathogenesis?

Transcriptome analysis provides valuable insights into gene expression patterns that can illuminate the functional role of NMCC_0461 in N. meningitidis pathogenesis . Previous studies using ex vivo models of human whole blood infection have shown that N. meningitidis alters the expression of approximately 30% of its genome during blood adaptation .

To apply this approach to NMCC_0461:

  • Design time-course experiments using relevant host environments (blood, cerebrospinal fluid)

  • Compare expression profiles between wildtype and NMCC_0461 knockout strains

  • Look for co-regulated genes that may function in the same pathway as NMCC_0461

  • Analyze enriched biological pathways to contextualize NMCC_0461's role

During blood infection, N. meningitidis activates several genes encoding surface-exposed proteins, detoxifying enzymes, and iron uptake systems . Understanding whether NMCC_0461 is part of these response networks can provide clues to its function in pathogenesis.

The following table summarizes key findings from transcriptome studies of N. meningitidis in human blood that might inform NMCC_0461 research:

Response CategoryExamples of Regulated GenesPotential Relevance to NMCC_0461
Surface-exposed proteinsfHbp, NspAPossible interaction partners if NMCC_0461 is surface-exposed
Detoxifying enzymesSodC, Kat, AniAMay function in the same stress response pathway
Iron uptake systemsAll genes regulated by FurCould indicate role in nutrient acquisition
Transcriptional regulatorsFur regulatorPotential regulatory mechanism for NMCC_0461 expression

What methodological approaches are recommended for investigating protein-protein interactions involving NMCC_0461?

As a membrane protein, studying interactions involving NMCC_0461 requires specialized techniques to preserve native conformation and capture authentic interactions. The following methodological approaches are recommended:

  • Co-immunoprecipitation (Co-IP)

    • Express NMCC_0461 with an epitope tag (e.g., His-tag as used in the recombinant protein)

    • Use mild detergents to solubilize membranes while preserving protein interactions

    • Capture NMCC_0461 and associated proteins using affinity chromatography

    • Identify binding partners by mass spectrometry

  • Bacterial two-hybrid system

    • Particularly useful for membrane proteins

    • Enables screening against a library of potential interacting partners

    • Can detect both strong and weak interactions

  • Surface plasmon resonance (SPR)

    • Quantitative measurement of binding kinetics

    • Requires purified recombinant NMCC_0461

    • Can test specific hypothesized interactions

When investigating NMCC_0461 interactions, prioritize testing proteins known to be important for N. meningitidis survival in blood, such as factor H binding proteins (fHbp and NspA), as these represent possible functional partners in pathogenesis .

How might NMCC_0461 contribute to N. meningitidis survival in human blood?

Understanding NMCC_0461's potential role in blood survival is crucial given the importance of bloodstream invasion in meningococcal pathogenesis . Previous studies have identified several mechanisms by which N. meningitidis adapts to the bloodstream:

  • Iron acquisition: N. meningitidis significantly upregulates genes encoding iron uptake systems during blood infection, as iron is a limiting nutrient in the human host . NMCC_0461, as a membrane protein, could potentially be involved in iron transport or regulation.

  • Immune evasion: Factor H binding proteins (fHbp and NspA) are upregulated during blood infection and help the bacterium evade complement-mediated killing . NMCC_0461 might interact with these proteins or independently contribute to immune evasion.

  • Metabolic adaptation: N. meningitidis shows major changes in energy metabolism genes during blood infection . The UPF0761 family, to which NMCC_0461 belongs, has not been functionally characterized but may play a role in these metabolic shifts.

To investigate NMCC_0461's contribution to blood survival, researchers should:

  • Generate NMCC_0461 knockout mutants

  • Perform whole blood survival assays comparing wildtype and mutant strains

  • Assess sensitivity to specific blood components (complement, antimicrobial peptides)

  • Examine changes in membrane integrity under blood-mimicking conditions

How should researchers interpret contradictory data regarding NMCC_0461 function across different experimental systems?

Contradictory results are common in research on poorly characterized proteins like NMCC_0461. A systematic approach to reconciling discrepancies includes:

When encountering contradictory data, perform controlled experiments to directly test hypotheses explaining the contradictions. For example, if NMCC_0461 shows different phenotypes in different N. meningitidis strains, express both variants in a neutral background to compare their function directly.

What are the special considerations for proteomic analysis of NMCC_0461 and its interacting partners?

Proteomic analysis of membrane proteins like NMCC_0461 presents unique challenges requiring specialized approaches:

  • Sample preparation:

    • Use membrane-compatible detergents (e.g., n-dodecyl-β-D-maltoside, digitonin)

    • Consider chemical crosslinking to capture transient interactions

    • Employ subcellular fractionation to enrich for membrane proteins

  • Mass spectrometry considerations:

    • Trypsin digestion may be inefficient for hydrophobic regions

    • Alternative proteases (e.g., chymotrypsin, thermolysin) may improve coverage

    • Special acquisition methods like SWATH-MS can improve detection of low-abundance peptides

  • Data analysis:

    • Set appropriate thresholds for significance in interaction studies

    • Use specialized algorithms for transmembrane protein identification

    • Validate key findings with orthogonal methods (co-IP, FRET)

When analyzing proteomic data for NMCC_0461, focus on enrichment of functional categories among interacting partners. Previous studies in N. meningitidis have shown that membrane proteins often cluster in functional complexes related to nutrient acquisition, stress response, or host interaction .

How can NMCC_0461 research contribute to understanding pathogenesis in Neisseria meningitidis?

Research on NMCC_0461 has potential to advance our understanding of N. meningitidis pathogenesis in several ways:

  • Adaptation to host environments: N. meningitidis encounters multiple environments within the host, requiring rapid adaptation for survival . As a membrane protein, NMCC_0461 may participate in sensing environmental changes or mediating adaptive responses.

  • Virulence factor interaction: Several surface-exposed proteins in N. meningitidis are important for blood survival and immune evasion . NMCC_0461 may interact with these known virulence factors or function independently in pathogenesis.

  • Novel therapeutic targets: If NMCC_0461 proves important for bacterial survival in blood, it could represent a novel target for antimicrobial development. Membrane proteins often make excellent drug targets due to their accessibility.

Studies with lipid A mutants of N. meningitidis have shown that alterations in membrane components can significantly affect clinical presentation, with lpxL1 mutants showing reduced inflammatory responses . Similar studies with NMCC_0461 mutants could reveal whether this protein contributes to specific disease manifestations.

What are promising future research directions for understanding NMCC_0461 function?

Based on current knowledge gaps, several research directions could advance understanding of NMCC_0461:

  • Structural characterization:

    • Cryo-electron microscopy of NMCC_0461 in nanodiscs

    • Hydrogen-deuterium exchange mass spectrometry to map accessible regions

    • Computational modeling using AlphaFold or similar tools

  • Functional genomics:

    • CRISPR interference to modulate NMCC_0461 expression levels

    • Transposon mutagenesis to identify synthetic lethal interactions

    • RNA-Seq comparing wildtype and NMCC_0461 mutants across conditions

  • Host-pathogen interactions:

    • Study NMCC_0461 expression in different host cell types

    • Investigate impact on immune cell recognition and activation

    • Examine role in biofilm formation and colonization

  • Evolutionary analysis:

    • Compare NMCC_0461 sequences across Neisseria species and strains

    • Identify evidence of selective pressure suggesting host adaptation

    • Investigate horizontal gene transfer events involving NMCC_0461

These approaches, combined with rigorous experimental design principles , will help elucidate the function of this uncharacterized membrane protein and its potential role in meningococcal pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.