Recombinant Nelsonia neotomodon NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Nelsonia neotomodon MT-ND3 is synthesized using heterologous expression systems to replicate the native protein structure. Key features include:

PropertyDetails
UniProt IDO21572
Molecular Weight~13 kDa
Amino Acid Sequence1–115 residues: MNmLVTmLINTTLSFVLILIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMK...
Expression SystemOptimized for high-yield production in prokaryotic or eukaryotic hosts
StorageTris-based buffer with 50% glycerol; store at -20°C (avoid freeze-thaw)
PurityValidated via SDS-PAGE and Western blot

The protein retains the conserved structural motifs of MT-ND3, including hydrophobic transmembrane domains critical for anchoring Complex I to the mitochondrial inner membrane .

Functional Role in Complex I

As a core subunit of Complex I (NADH:ubiquinone oxidoreductase), recombinant MT-ND3 contributes to:

  • Electron Transfer: Mediates electron flow from NADH to ubiquinone via iron-sulfur clusters .

  • Proton Translocation: Supports conformational changes that drive proton pumping across the mitochondrial membrane .

  • Structural Stability: Forms part of the hydrophobic core essential for Complex I assembly .

Studies on mammalian MT-ND3 homologs reveal that mutations in this subunit disrupt Complex I activity, leading to mitochondrial disorders like Leigh syndrome and Leber’s hereditary optic neuropathy . While Nelsonia neotomodon-derived MT-ND3 is primarily used in comparative studies, its recombinant form enables biochemical assays to probe these mechanisms .

Disease Modeling

Recombinant MT-ND3 is utilized to:

  • Investigate pathogenicity of MT-ND3 variants linked to mitochondrial encephalopathies .

  • Test rescue strategies for Complex I deficiencies, such as codon-optimized gene therapies .

Antibody Validation

Commercial antibodies (e.g., Cell Signaling Technology #45859, Abcam ab192306) targeting MT-ND3 are validated using this recombinant protein in Western blotting and immunoprecipitation .

Key Research Findings

  • Functional Rescue: Nuclear expression of codon-optimized MT-ND3 restored ATP synthesis in patient-derived cells with pathogenic m.10191T>C and m.10197G>C variants, demonstrating therapeutic potential .

  • Inhibitor Binding: Structural analyses show MT-ND3’s proximity to ubiquinone-binding sites, explaining how mutations impair electron transfer and increase oxidative stress .

  • Conservation: Nelsonia neotomodon MT-ND3 shares >80% sequence homology with human MT-ND3, making it a viable model for evolutionary studies of mitochondrial genome adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Nelsonia neotomodon (Diminutive woodrat)
Target Names
Target Protein Sequence
MNMLVTMLINTTLSFVLILIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPMPWAMQTQDIKTMTLTAFILLSVLALGLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This protein is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of MT-ND3 in the mitochondrial Complex I of Nelsonia neotomodon?

MT-ND3 is a core subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which is essential for electron transfer from NADH to ubiquinone in the respiratory chain. In Nelsonia neotomodon, as in other mammals, MT-ND3 is encoded by mitochondrial DNA and plays a critical role in the proton-pumping mechanism of Complex I. This subunit is positioned within the membrane domain (P module) of Complex I, contributing to the structural integrity of the enzyme complex and participating in the coupling of electron transfer to proton translocation .

The functional importance of MT-ND3 is evidenced by its conservation across species and its involvement in mitochondrial disorders when mutated. In the context of the complete Complex I structure, MT-ND3 interacts with both core and accessory subunits, helping maintain the quaternary structure necessary for enzymatic activity .

How does MT-ND3 from Nelsonia neotomodon differ from homologous proteins in other rodent species?

While specific comparative data for Nelsonia neotomodon MT-ND3 is limited, analysis of mitochondrial proteins across rodent species suggests several notable characteristics. N. neotomodon, being endemic to Mexico, may exhibit region-specific adaptations in its mitochondrial proteins .

Comparative analysis indicates that while the functional domains of MT-ND3 remain highly conserved across rodents, species-specific variations typically occur in non-catalytic regions. These variations may reflect adaptations to different metabolic demands, environmental conditions, or evolutionary pressures. Researchers should note that these differences, though subtle, can affect antibody recognition, protein-protein interactions, and potentially functional characteristics when conducting heterologous expression studies.

What are the essential parameters for validating recombinant MT-ND3 expression?

Validation of recombinant MT-ND3 expression requires multiple analytical approaches:

  • Protein Identification: SDS-PAGE followed by western blotting using antibodies specific to MT-ND3 or to incorporated tags. Mass spectrometry confirmation is recommended for definitive identification.

  • Purity Assessment: Two-dimensional gel electrophoresis to detect potential contaminants or modifications .

  • Structural Integrity: Circular dichroism spectroscopy to verify proper secondary structure formation.

  • Functional Validation: Enzymatic activity assays measuring NADH oxidation rates. A properly folded recombinant MT-ND3 should be capable of assembly with other Complex I components, leading to restoration of NADH:ubiquinone oxidoreductase activity in reconstitution experiments .

  • Subcellular Localization: When expressed in cellular systems, recombinant MT-ND3 should demonstrate appropriate mitochondrial targeting.

What expression systems are most effective for producing functional recombinant MT-ND3 from Nelsonia neotomodon?

The expression of functional recombinant MT-ND3 presents significant challenges due to its hydrophobic nature and mitochondrial origin. Based on comparative studies with other mitochondrially-encoded proteins:

Prokaryotic Systems:

  • E. coli: While commonly used, often results in inclusion bodies requiring refolding. Success has been achieved using specialized strains (C41/C43) and fusion partners (SUMO, thioredoxin) to enhance solubility.

  • Cell-free systems: Allow direct incorporation into nanodiscs or liposomes, potentially preserving native conformation.

Eukaryotic Systems:

  • Yeast (P. pastoris, S. cerevisiae): Provide mitochondrial machinery that may facilitate proper folding.

  • Insect cells (Sf9, High Five): Balance between protein yield and eukaryotic post-translational modifications.

  • Mammalian cells: Most physiologically relevant but with lower yields. HEK293 or CHO cells typically provide the most faithful processing.

The optimal approach involves codon optimization for the expression system, incorporation of purification tags that minimally impact structure, and expression conditions that slow protein production (lower temperature, reduced inducer concentration) to facilitate proper folding.

What purification strategies maximize yield and activity of recombinant MT-ND3?

Purification of recombinant MT-ND3 requires strategies that maintain the protein's native conformation while separating it from contaminants:

  • Solubilization: Detergent selection is critical. Mild detergents such as DDM, LMNG, or digitonin better preserve protein structure compared to harsh detergents like SDS or Triton X-100 .

  • Chromatographic Approaches:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography as a polishing step

  • Buffer Optimization: Inclusion of glycerol (10-15%), reducing agents, and appropriate salt concentrations helps maintain stability.

  • Reconstitution: For functional studies, reconstitution into proteoliposomes or nanodiscs is often necessary. This requires careful detergent removal via dialysis, adsorption to hydrophobic resins, or cyclodextrin-mediated extraction.

A typical yield from optimized bacterial systems ranges from 0.5-2 mg per liter of culture, while eukaryotic systems typically produce 0.1-0.5 mg per liter.

What assays accurately measure the enzymatic activity of recombinant MT-ND3 within reconstituted Complex I?

Measuring the enzymatic activity of MT-ND3 requires assessing its function within the context of assembled Complex I. The following assays are recommended:

  • NADH:Ubiquinone Oxidoreductase Activity Assay: The gold standard for Complex I functionality, measuring the rate of NADH oxidation coupled to ubiquinone reduction . This spectrophotometric assay tracks NADH absorbance decrease at 340 nm. Critical parameters include:

    • Reaction buffer: 50 mM potassium phosphate (pH 7.5), 3 mg/mL BSA

    • Substrates: 100 μM NADH, 60 μM ubiquinone

    • Inhibitor control: 10 μM rotenone to verify specificity

  • Proton Pumping Assays: Measures the ability of reconstituted Complex I to generate a proton gradient using pH-sensitive fluorescent dyes (ACMA or pyranine) in proteoliposomes.

  • Electron Paramagnetic Resonance (EPR): Provides information on the redox states of iron-sulfur clusters in Complex I, indirectly reflecting the integrity of the electron transfer path influenced by MT-ND3.

  • Oxygen Consumption Measurements: High-resolution respirometry using substrates that feed electrons to Complex I (such as pyruvate/malate) can assess integrated function in mitochondrial preparations or reconstituted systems .

Table 1. Comparative Data for Complex I Activity Assays with Recombinant MT-ND3

Assay MethodSensitivitySpecificityTechnical ComplexityEquipment Requirements
NADH:Ubiquinone Oxidoreductase ActivityHighHigh (with rotenone control)ModerateSpectrophotometer
Proton PumpingModerateHighHighFluorometer with rapid mixing
EPR SpectroscopyModerateHighVery HighEPR Spectrometer
Oxygen ConsumptionHighModerate (requires inhibitors)ModerateRespirometer

How can the interaction between recombinant MT-ND3 and other Complex I subunits be accurately characterized?

Characterizing the interactions between MT-ND3 and other Complex I subunits requires techniques that can detect and quantify protein-protein interactions while maintaining the native-like environment needed for membrane proteins:

  • Co-immunoprecipitation: Using antibodies against MT-ND3 or partner proteins to pull down complexes, followed by identification of binding partners via mass spectrometry.

  • Cross-linking Coupled to Mass Spectrometry (XL-MS): Chemical crosslinkers create covalent bonds between interacting proteins, which are then identified by mass spectrometry to map interaction interfaces.

  • Förster Resonance Energy Transfer (FRET): For recombinant systems where fluorescent tags can be incorporated, FRET can detect proximity between MT-ND3 and other subunits in a dynamic context.

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST): These techniques can measure binding kinetics and affinities between MT-ND3 and isolated partner subunits.

  • Cryo-electron Microscopy: For structural characterization of the fully assembled complex, cryo-EM can provide insight into the position and interactions of MT-ND3 within the complex architecture at near-atomic resolution.

The choice of method depends on whether the goal is to identify unknown interactions, confirm predicted ones, or characterize the strength and dynamics of known interactions.

How can recombinant MT-ND3 be utilized to study pathogen interactions with mitochondrial Complex I?

Recombinant MT-ND3 provides a valuable tool for investigating pathogen-mitochondria interactions, particularly in the context of viruses that target mitochondrial function. This approach offers several research applications:

  • Viral Protein Binding Studies: Recombinant MT-ND3 can be used in interaction assays with viral proteins known to target mitochondria. For example, the Dengue virus NS3 protein has been shown to inhibit Complex I activity . Similar methodologies could be applied to study interactions between viral proteins and MT-ND3.

  • Protective Mechanism Screening: By establishing MT-ND3 activity assays, researchers can screen for compounds or peptides that prevent pathogen-induced dysfunction of Complex I.

  • Species-Specific Vulnerability Comparison: Comparing the interaction of viral proteins with MT-ND3 from different species (including Nelsonia neotomodon) could reveal evolutionary adaptations that confer resistance or susceptibility to pathogen-induced mitochondrial dysfunction.

  • Structural Biology Approaches: Co-crystallization or cryo-EM studies of MT-ND3 with viral proteins can identify the precise binding interfaces and mechanisms of inhibition, potentially informing therapeutic strategies.

Research using Dengue virus NS3 has demonstrated that viral proteins can directly impair Complex I function through proteolytic mechanisms . Similar approaches could be applied using recombinant MT-ND3 to study other pathogen interactions.

What experimental approaches can determine the effect of post-translational modifications on MT-ND3 function?

Post-translational modifications (PTMs) of MT-ND3 can significantly alter its function within Complex I. The following experimental approaches can systematically investigate these effects:

  • Site-Directed Mutagenesis: Generate recombinant MT-ND3 variants with mutations at known or predicted PTM sites to create phosphomimetic (e.g., S→D) or modification-deficient (e.g., K→R) variants.

  • In Vitro Modification Systems: Treat purified recombinant MT-ND3 with specific enzymes (kinases, acetylases, etc.) to introduce controlled modifications.

  • Mass Spectrometry-Based PTM Mapping: Use targeted proteomics approaches to identify and quantify PTMs under different conditions:

    • Parallel Reaction Monitoring (PRM)

    • Selected Reaction Monitoring (SRM)

    • Data-independent acquisition (DIA)

  • Functional Assays of Modified Protein: Compare activity of modified and unmodified MT-ND3 using:

    • NADH:ubiquinone oxidoreductase activity assays

    • Protein stability assessments

    • Assembly efficiency into Complex I

  • Structural Analysis: Use techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes induced by PTMs.

These approaches can reveal how specific modifications affect MT-ND3 function in response to metabolic shifts, stress conditions, or pathological states.

What are the primary challenges in achieving proper folding of recombinant MT-ND3, and how can they be addressed?

Recombinant MT-ND3 presents several folding challenges due to its hydrophobic nature and mitochondrial origin:

  • Membrane Protein Solubility: As a hydrophobic protein normally embedded in the mitochondrial inner membrane, MT-ND3 tends to aggregate when expressed in heterologous systems.

    • Solution: Use specialized membrane protein expression strains, fusion with solubility-enhancing tags (MBP, SUMO), and careful detergent selection during purification .

  • Absence of Native Chaperones: Mitochondrial proteins normally benefit from specialized chaperone systems absent in bacterial expression hosts.

    • Solution: Co-expression with mitochondrial chaperones (HSP60, HSP10) or use of eukaryotic expression systems with intact mitochondrial import machinery.

  • Oxidative Environment: The redox environment affects disulfide bond formation and protein folding.

    • Solution: Control expression conditions (temperature, aeration) and include appropriate reducing agents in buffers.

  • Assembly-Dependent Folding: Some subunits only adopt their final conformation when assembled with partner proteins.

    • Solution: Co-expression with interacting subunits or reconstitution approaches that facilitate assembly.

  • Post-Translational Processing: Mitochondrial proteins often undergo proteolytic processing upon import.

    • Solution: Express mature form without mitochondrial targeting sequences or include processing proteases in the expression system.

Success rates can be monitored using conformation-specific antibodies or limited proteolysis assays that distinguish properly folded protein from misfolded variants.

How can researchers address the challenge of distinguishing between direct effects on MT-ND3 and indirect effects on Complex I assembly?

This methodological challenge requires careful experimental design:

  • Isolation of Direct Effects:

    • Use purified recombinant MT-ND3 in reconstitution experiments with pre-assembled subcomplexes lacking MT-ND3

    • Develop assays specific to MT-ND3 function rather than whole complex activity

    • Employ rapid kinetic measurements to detect immediate effects before assembly changes occur

  • Assembly Monitoring Techniques:

    • Blue Native PAGE to visualize intact complexes and assembly intermediates

    • Pulse-chase experiments to track the incorporation of newly synthesized MT-ND3 into the complex

    • Proximity labeling (BioID, APEX) to map the interaction partners of MT-ND3 under different conditions

  • Complementary Approaches:

    • Create MT-ND3 variants with mutations that specifically affect function but not assembly

    • Use conditional expression systems to control timing of MT-ND3 availability

    • Apply computational modeling to predict and distinguish assembly vs. functional effects

  • Controls and Validation:

    • Include assembly-defective but catalytically competent mutants as controls

    • Compare effects with other Complex I subunits to identify MT-ND3-specific phenomena

    • Validate in multiple systems (in vitro, cell culture, organelle isolates)

By systematically employing these strategies, researchers can disentangle the direct functional contributions of MT-ND3 from its role in complex assembly and stability.

How can computational modeling enhance our understanding of MT-ND3 dynamics within Complex I?

Computational approaches offer valuable insights into MT-ND3 function beyond what experimental techniques alone can provide:

  • Molecular Dynamics Simulations: Allow observation of MT-ND3 behavior within the lipid bilayer environment over nanosecond to microsecond timescales.

    • Conformational changes during the catalytic cycle

    • Lipid-protein interactions that stabilize the complex

    • Proton translocation pathways involving MT-ND3

  • Quantum Mechanics/Molecular Mechanics (QM/MM): For studying electron transfer processes and how MT-ND3 may influence these reactions.

  • Homology Modeling and Threading: When experimental structures are unavailable, predictive modeling can generate structural hypotheses for Nelsonia neotomodon MT-ND3 based on homologous proteins.

  • Protein-Protein Docking: Predicts interaction interfaces between MT-ND3 and other Complex I subunits or potential binding partners.

  • Systems Biology Approaches: Integrates MT-ND3 function into broader metabolic networks to understand downstream effects of MT-ND3 modifications.

Implementation requires:

  • Carefully parameterized force fields appropriate for membrane proteins

  • Integration of experimental constraints from cross-linking or spectroscopic data

  • Validation of models against experimental observables

  • Sufficient computational resources for adequate sampling

These computational approaches can generate testable hypotheses about MT-ND3 function that guide subsequent experimental work.

What evolutionary insights can be gained from comparative analysis of MT-ND3 across diverse mammalian species including Nelsonia neotomodon?

Evolutionary analysis of MT-ND3 across mammalian species provides insights into functional constraints, adaptation mechanisms, and potentially species-specific properties:

  • Selection Pressure Analysis: Calculating dN/dS ratios across MT-ND3 sequences identifies regions under purifying selection (functionally critical) versus positive selection (potentially adaptive).

  • Coevolution Detection: Methods such as Direct Coupling Analysis (DCA) or Mutual Information (MI) can identify co-evolving residues within MT-ND3 or between MT-ND3 and other Complex I subunits.

  • Ancestral Sequence Reconstruction: Reconstructing the evolutionary history of MT-ND3 in rodents can reveal when key adaptations emerged.

  • Ecological Correlation: Correlating MT-ND3 sequence features with ecological factors (altitude, temperature range, metabolic rate) across species.

  • Structural Mapping of Variation: Projecting species differences onto structural models to identify whether variations cluster in functional regions.

For Nelsonia neotomodon specifically, as an endemic Mexican species , comparative analysis might reveal adaptations to its particular ecological niche. Given its distinct evolutionary history, N. neotomodon MT-ND3 may contain unique features that reflect adaptations to local environmental conditions or metabolic requirements.

The integration of these evolutionary analyses with functional studies can provide a more comprehensive understanding of how MT-ND3 structure-function relationships have been shaped through evolutionary time.

What is the optimal protocol for measuring the inhibitory effects of compounds on recombinant MT-ND3 function?

The following standardized protocol enables precise measurement of inhibitory effects on MT-ND3 function within Complex I:

  • Sample Preparation:

    • Reconstituted Complex I containing recombinant MT-ND3 (50-100 μg/mL final concentration)

    • Reaction buffer: 50 mM potassium phosphate (pH 7.5), 3 mg/mL fatty acid-free BSA, 300 μM KCN

    • Test compounds prepared in DMSO (final DMSO concentration ≤1%)

  • Assay Procedure:

    • Pre-incubate enzyme preparation with test compound for 10-30 minutes at appropriate temperature

    • Initiate reaction by adding 100 μM NADH followed by 60 μM ubiquinone

    • Monitor NADH oxidation by absorbance decrease at 340 nm for 2-5 minutes

    • Add 10 μM rotenone as a positive control for inhibition

  • Data Analysis:

    • Calculate initial reaction rates using the NADH extinction coefficient (6.2 mM⁻¹ cm⁻¹)

    • Generate dose-response curves with minimum 5-7 concentrations of test compound

    • Determine IC₅₀ values using appropriate curve-fitting algorithms

    • Calculate Ki values if mechanism of inhibition is determined

  • Controls and Validation:

    • DMSO-only control to account for solvent effects

    • Known inhibitors (rotenone, piericidin A) as positive controls

    • Heat-inactivated enzyme as negative control

    • Secondary assays (oxygen consumption, proton pumping) to confirm findings

This protocol allows for standardized comparison between different inhibitors and can be adapted to high-throughput screening formats using plate readers for drug discovery applications.

What methodology should be used to investigate the role of MT-ND3 in reactive oxygen species production?

Investigating MT-ND3's role in reactive oxygen species (ROS) production requires a multi-faceted approach:

  • Real-time ROS Detection:

    • Amplex Red assay for hydrogen peroxide quantification

    • Electron Paramagnetic Resonance (EPR) with spin traps for superoxide detection

    • Fluorescent probes (MitoSOX, DCF) for localized detection in cellular systems

  • Site-Directed Mutagenesis Strategy:

    • Generate MT-ND3 variants at residues hypothesized to influence ROS production

    • Focus on residues near the quinone-binding site or proton translocation pathway

    • Compare wildtype and mutant MT-ND3 in reconstituted systems

  • Experimental Conditions:

    • Vary substrate concentrations (NADH, ubiquinone)

    • Test under forward and reverse electron transport conditions

    • Examine effects of membrane potential using ionophores

    • Measure under normal and inhibited states (partial inhibition often increases ROS)

  • Data Interpretation Framework:

    • Correlate ROS production with enzyme activity to normalize for assembly differences

    • Consider both absolute ROS levels and ROS production as a percentage of electron flux

    • Examine the balance between different ROS species (superoxide vs. hydrogen peroxide)

This methodological approach enables researchers to determine whether specific regions of MT-ND3 contribute to ROS production sites within Complex I, potentially identifying targets for therapeutic intervention in conditions characterized by mitochondrial oxidative stress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.