Recombinant Nematostella vectensis Protein SYS1 homolog (sys1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
sys1; v1g229542; Protein SYS1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Nematostella vectensis (Starlet sea anemone)
Target Names
sys1
Target Protein Sequence
MAAGFRTNVWDPVLIISQIIAIQCTFYISLGVWVLIVDYWSGSIHSLDQFFAYKELDISS LKGKLLMIAFCLNSLTGAMALWFIVKRAKQCLDFTTTAHIVHLVFCCIYAGFPFSWTWWL LNIICLALMAVIGEFVCMKTELKAIKVSAGSSGKNSV
Uniprot No.

Target Background

Function

Involved in protein trafficking.

Database Links
Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the Nematostella vectensis SYS1 homolog protein and why is it significant for research?

The SYS1 homolog protein from Nematostella vectensis (Starlet sea anemone) is a 157 amino acid protein with UniProt accession number A7S6Y0. Its significance stems from its evolutionary relationship to the β-catenin family of proteins, which are conserved regulators of metazoan development functioning with TCF DNA-binding proteins to activate transcription . In C. elegans, the similar SYS-1/β-catenin regulates asymmetric cell divisions and is critical for endodermal fate determination, suggesting the Nematostella homolog may serve comparable developmental functions . As Nematostella is a diploblastic cnidarian, studying its SYS1 homolog provides valuable insights into the ancestral functions of this protein family and evolutionary conservation of developmental pathways across metazoan lineages .

What are the optimal storage conditions for recombinant Nematostella vectensis SYS1 homolog protein?

Recombinant Nematostella vectensis SYS1 homolog protein should be stored at -20°C in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . For extended storage periods, conserve the protein at -80°C to minimize degradation . It is critical to avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and integrity. For short-term work, prepare working aliquots and store at 4°C for up to one week . When handling the protein, minimize exposure to room temperature and maintain sterile conditions to prevent contamination and proteolytic degradation.

How can Nematostella vectensis be maintained as a laboratory model organism?

Nematostella vectensis can be maintained in laboratory settings following established protocols. These sea anemones should be kept in artificial seawater at 18°C with regular light cycling . For regular spawning, implement a 14-day conditioning period with daily feeding, followed by water changes combined with 13 hours of exposure to bright light and elevated temperature (25°C) . After this treatment, maintain the anemones under bright light at 18°C and monitor for spawning every 15 minutes .

This protocol is more effective than the 7-day schedule which can result in diminished fecundity over time . The anemones can be fed regularly with Artemia nauplii or other appropriate small invertebrates. Nematostella's simple culture requirements, transparency, and rapid generation time (approximately 50 days from fertilized egg to sexually mature adult) make it an ideal model organism for developmental studies .

What methods are most effective for studying protein expression patterns of SYS1 homolog in Nematostella vectensis embryos?

For studying SYS1 homolog expression patterns in Nematostella embryos, a combination of approaches yields the most comprehensive results:

  • Fluorescent protein tagging: Similar to the VNS::SYS-1 fusion approach used in C. elegans , creating a VENUS fluorescent protein fusion with the Nematostella SYS1 homolog allows visualization of protein distribution in living embryos. This technique is particularly powerful in Nematostella due to its transparency throughout development .

  • Whole-mount immunohistochemistry: Using antibodies against the SYS1 homolog protein with confocal microscopy enables precise spatial localization. The two-tissue layer simplicity of Nematostella facilitates excellent antibody penetration and clear imaging .

  • In situ hybridization: For mRNA expression pattern analysis, chromogenic or fluorescent in situ hybridization can be performed using probes specific to the sys1 gene sequence.

  • Western blotting with developmental staging: To quantify protein levels at different developmental timepoints from unfertilized eggs through juvenile polyp stages.

The transparent nature of Nematostella throughout its life cycle makes it particularly amenable to these visualization techniques, allowing for observation of internal protein dynamics without the need for dissection .

How can RNA interference (RNAi) be optimized for functional studies of SYS1 homolog in Nematostella vectensis?

Optimizing RNAi for functional studies of the SYS1 homolog in Nematostella requires careful consideration of several methodological factors:

  • dsRNA design: Design multiple non-overlapping dsRNAs targeting different regions of the sys1 transcript to ensure specific knockdown. Include a minimum of 300-500 bp fragments for efficient RNAi.

  • Delivery method: Microinjection of dsRNA directly into zygotes provides the most consistent knockdown. Alternatively, soaking embryos in dsRNA with a lipid-based transfection reagent can be effective for batch treatments.

  • Controls: Include both negative controls (non-targeting dsRNA) and positive controls (dsRNA against genes with known phenotypes) to validate the RNAi efficiency in each experiment.

  • Phenotypic analysis: Given that SYS-1 in C. elegans is critical for endodermal fate determination , focus phenotypic analysis on endoderm development, cell division patterns, and axis formation in Nematostella embryos.

  • Quantification: Measure knockdown efficiency through qRT-PCR and western blotting, comparing target gene/protein levels between experimental and control samples.

  • Rescue experiments: Perform rescue experiments with RNAi-resistant versions of the sys1 gene to confirm phenotype specificity.

When analyzing results, consider potential functional redundancy with other β-catenin-like proteins in Nematostella that might mask phenotypes.

How does the SYS1 homolog in Nematostella vectensis compare functionally to SYS-1/β-catenin in C. elegans?

The functional comparison between Nematostella SYS1 homolog and C. elegans SYS-1/β-catenin reveals both conserved and divergent aspects:

FeatureC. elegans SYS-1/β-cateninNematostella SYS1 homologSignificance
Structural characteristicsβ-catenin-like proteinContains β-catenin domainsSuggests conservation of core functional domains
Developmental roleRegulates asymmetric cell divisions Likely involved in early developmental patterningIndicates potential conservation of developmental functions
Subcellular localizationAsymmetrically distributed; nuclear accumulation in specific daughter cells Distribution pattern requires investigationMay reveal conserved regulatory mechanisms
Interaction with TCFInteracts with POP-1/TCF to activate transcription Predicted to interact with Nematostella TCF homologsSuggests conservation of Wnt signaling components
RegulationPosttranslational control involving frizzled and dishevelled homologs Regulatory mechanisms need explorationCould reveal ancestral regulatory pathways
Expression patternReciprocal to POP-1 expression Expression pattern requires characterizationMay indicate conservation of expression regulation

To definitively establish functional homology, experimental approaches should include: (1) expression of Nematostella SYS1 in C. elegans sys-1 mutants to test for rescue; (2) co-immunoprecipitation studies to identify binding partners; and (3) CRISPR/Cas9-mediated gene editing to create sys1 mutants in Nematostella and characterize resulting phenotypes .

What approaches can be used to investigate the potential role of SYS1 homolog in asymmetric cell divisions in Nematostella vectensis?

Based on the role of SYS-1 in C. elegans asymmetric cell divisions , several sophisticated approaches can be employed to investigate similar functions in Nematostella:

  • Live-cell imaging with transgenic reporters: Generate transgenic Nematostella lines expressing fluorescently tagged SYS1 homolog along with markers for cell polarity. Employ 4D microscopy to track protein dynamics during cell divisions in developing embryos.

  • Laser ablation studies: Perform targeted cell ablation experiments to assess the role of SYS1-expressing cells in developmental fate decisions.

  • Chromatin immunoprecipitation sequencing (ChIP-seq): Identify genomic targets of SYS1-TCF complexes to elucidate transcriptional networks controlled by this pathway.

  • CRISPR-Cas9 genome editing: Generate precise mutations in the sys1 gene and in potential binding partners to assess phenotypic consequences.

  • Protein interaction studies: Use bimolecular fluorescence complementation (BiFC) or proximity ligation assays (PLA) to visualize SYS1 interactions with TCF proteins in situ.

  • Quantitative asymmetry analysis: Develop computational methods to measure protein concentration gradients across dividing cells, similar to the approach used for analyzing SYS-1/POP-1 reciprocal asymmetry in C. elegans .

These approaches leverage Nematostella's transparency and amenability to genetic manipulation, providing powerful tools for dissecting the molecular mechanisms of asymmetric cell divisions in this basal metazoan .

What are the main challenges in producing high-quality recombinant Nematostella vectensis SYS1 homolog protein and how can they be addressed?

Producing high-quality recombinant Nematostella SYS1 homolog protein presents several challenges that can be addressed through methodological refinements:

  • Protein solubility issues: SYS1 homolog, like other β-catenin family proteins, may have solubility limitations during recombinant expression.

    • Solution: Express the protein with solubility-enhancing tags such as SUMO, MBP, or TRX. Optimize buffer conditions with glycerol (as used in the commercial preparation) and mild detergents .

  • Proper folding: Ensuring correct tertiary structure is essential for functional studies.

    • Solution: Express protein at lower temperatures (16-18°C) to slow folding. Consider using chaperone co-expression systems in the expression host.

  • Purification efficiency: Obtaining high purity preparations without degradation.

    • Solution: Implement a two-step purification strategy using affinity chromatography followed by size exclusion. Include protease inhibitors throughout the purification process .

  • Stability during storage: Preventing degradation during storage.

    • Solution: Store in optimized buffer conditions with 50% glycerol at -20°C for routine use or -80°C for long-term storage. Aliquot to avoid freeze-thaw cycles .

  • Functionality verification: Confirming the recombinant protein retains native activity.

    • Solution: Develop activity assays based on known β-catenin functions, such as DNA binding assays with TCF partners or cell-free transcription systems.

The commercial Nematostella vectensis SYS1 homolog preparation addresses several of these challenges through optimized buffer composition and storage recommendations, which should be followed closely for research applications .

How can researchers troubleshoot inconsistent results when studying SYS1 homolog function across different Nematostella populations?

Inconsistent results when studying SYS1 homolog function across different Nematostella populations may stem from several factors that should be systematically addressed:

  • Genetic variation: Natural populations of Nematostella vectensis exhibit substantial genetic diversity, similar to the intraspecies cryptic variation observed in other developmental systems .

    • Solution: Establish and use standardized laboratory strains with documented genetic backgrounds. Consider creating isogenic lines through multiple generations of self-fertilization.

  • Environmental influences on gene expression: Culture conditions can significantly affect gene expression and protein function.

    • Solution: Implement strictly standardized culture protocols across experiments, controlling temperature, salinity, pH, feeding regimes, and light cycles .

  • Developmental timing differences: Subtle variations in developmental staging can lead to apparent functional differences.

    • Solution: Develop precise staging criteria based on morphological landmarks and time post-fertilization. Document exact developmental stages in all experiments .

  • Technical variation in protein detection: Differences in antibody lots or detection methods can create artificial variation.

    • Solution: Use consistent lots of antibodies or detection reagents. Include internal controls and standard curves in all experiments.

  • Maternal contribution effects: Maternal SYS1 protein or mRNA may mask zygotic phenotypes.

    • Solution: Design experiments that can distinguish between maternal and zygotic contributions, such as maternal-specific RNAi or carefully timed protein inhibition.

When encountering population-specific differences, researchers should consider whether these represent biologically meaningful variation (as seen in C. elegans wild isolates with SKN-1 requirements ) or technical artifacts that need to be controlled.

How can studies of Nematostella vectensis SYS1 homolog contribute to our understanding of evolution of developmental pathways?

Studies of the Nematostella vectensis SYS1 homolog can significantly advance our understanding of developmental pathway evolution through several avenues:

  • Ancestral state reconstruction: As a member of Cnidaria, Nematostella represents an early-branching metazoan lineage. Characterizing SYS1 function provides insights into ancestral states of β-catenin signaling before the emergence of bilateral symmetry .

  • Comparative genomics approach: Systematic comparison of SYS1 structure, function, and regulatory networks between Nematostella and other model organisms (C. elegans, Drosophila, vertebrates) can reveal both conserved core components and lineage-specific innovations in developmental signaling .

  • Axis formation studies: Investigating SYS1's role in establishing body axes in Nematostella can illuminate the evolutionary origins of axial patterning mechanisms, particularly given SYS-1's role in asymmetric divisions in C. elegans .

  • Regulatory network evolution: By identifying transcriptional targets of SYS1 in Nematostella and comparing them with targets in other species, researchers can trace the evolution of developmental gene regulatory networks controlled by β-catenin proteins.

  • Protein interaction conservation: Examining whether Nematostella SYS1 interacts with TCF proteins in a manner similar to other organisms can reveal conservation of protein-protein interaction interfaces across vast evolutionary distances .

This research has broader implications for understanding how core developmental mechanisms emerged and diversified during animal evolution, potentially revealing fundamental principles that govern developmental processes across all metazoans.

What emerging technologies could enhance future research on SYS1 homolog function in Nematostella vectensis?

Several cutting-edge technologies hold promise for advancing research on SYS1 homolog function in Nematostella vectensis:

  • Single-cell transcriptomics and proteomics: These technologies can reveal cell-specific expression profiles and protein interactions of SYS1 at unprecedented resolution, allowing identification of subtle phenotypes and cell-type specific functions.

  • Optogenetic control systems: Developing light-inducible control of SYS1 activity would enable precise temporal and spatial manipulation of protein function, crucial for studying its role in asymmetric cell divisions.

  • Advanced live imaging techniques: Lattice light-sheet microscopy and adaptive optics can provide enhanced spatial and temporal resolution for visualizing SYS1 dynamics in living embryos, taking advantage of Nematostella's transparency .

  • CRISPR-based lineage tracing: Combining CRISPR editing with DNA barcoding can track cell lineages influenced by SYS1 function throughout Nematostella development.

  • Protein structure prediction and engineering: Leveraging AI-based protein structure prediction tools like AlphaFold2 can generate high-confidence structural models of Nematostella SYS1, informing functional studies and enabling structure-based protein engineering.

  • Tissue-specific gene regulation: Developing tissue-specific promoters for Nematostella would allow targeted manipulation of SYS1 expression in specific cell types.

  • Cryo-electron microscopy: This technology could be applied to determine the structure of SYS1 in complex with its binding partners, providing mechanistic insights into its function.

Integration of these technologies with established methods will provide multidimensional data on SYS1 function, accelerating our understanding of this protein's role in development and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.