Recombinant Neorickettsia sennetsu Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Neorickettsia sennetsu Glycerol-3-Phosphate Acyltransferase (plsY)

Recombinant Neorickettsia sennetsu Glycerol-3-phosphate acyltransferase (plsY) is an engineered protein derived from the bacterium Neorickettsia sennetsu, a member of the Anaplasmataceae family. This enzyme catalyzes the acylation of glycerol-3-phosphate (G3P), a critical step in lipid biosynthesis. The recombinant form is produced in E. coli with an N-terminal His-tag for purification and stability .

Amino Acid Sequence

A partial sequence of Neorickettsia sennetsu plsY includes:
MASAFEMNRLAFIIFVYVIAAIPFGRCISACFGVDICTRGSGNIGATNMTRVMGLGFGSVVFmLDFLKAAAPVFLAVQCCSDVFASTVGFVAVFAHVFSVYMAFKGGKGVAPMMGVYFVL .

Functional Role in Lipid Metabolism

Glycerol-3-phosphate acyltransferase (EC 2.3.1.15) catalyzes the transfer of an acyl group from acyl-CoA to sn-glycerol-3-phosphate, forming 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid) . In Neorickettsia, this enzyme is pivotal for synthesizing membrane lipids and may contribute to pathogen survival by modulating lipid composition .

Expression and Purification

  • Expression System: E. coli (His-tagged for affinity chromatography).

  • Reconstitution: Lyophilized powder resuspended in deionized water (0.1–1.0 mg/mL), with 5–50% glycerol for stability .

  • Storage: -20°C or -80°C; avoid repeated freeze-thaw cycles .

Applications

  • Immunological Studies: Used as an antigen in ELISA kits for detecting anti-Neorickettsia antibodies .

  • Biochemical Assays: Studied for its role in lipid biosynthesis and pathogen-host interactions.

Enzymatic Specificity

While canonical glycerol-3-phosphate acyltransferases acylate the sn-1 position, plant homologs (e.g., GPAT4/6) exhibit sn-2 specificity . Neorickettsia plsY’s positional specificity remains uncharacterized but is hypothesized to follow bacterial paradigms (sn-1 acylation) .

Comparative Analysis

FeatureNeorickettsia sennetsu plsYBacillus anthracis plsY3Streptococcus agalactiae plsY
Length191 aa198 aa207 aa
TagHisHisHis
Purity>90%>90%>90%
SourceE. coliE. coliE. coli

Challenges and Future Directions

  • Structural Insights: Limited 3D structural data for bacterial plsY homologs.

  • Functional Diversity: Potential roles in stress adaptation or host-pathogen interactions require further study .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; NSE_0738; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama) (Ehrlichia sennetsu)
Target Names
plsY
Target Protein Sequence
MASAFEMNRLAFIIFVYVIAAIPFGRCISACFGVDICTRGSGNIGATNMTRVMGLGFGSV VFMLDFLKAAAPVFLAVQCCSDVFASTVGFVAVFAHVFSVYMAFKGGKGVAPMMGVYFVL VLPVFIVAVCTWGIFFVLFRQPFISSLIACFIGAVYSYALLELYVFLPILAGTVLIFIRH TSNVREFLQAR
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Neorickettsia sennetsu and what disease does it cause?

Neorickettsia sennetsu is an obligate intracellular bacterium that infects monocytes and macrophages and is the causative agent of Sennetsu neorickettsiosis in humans . This disease was first documented in Japan in 1954, initially named sennetsu fever from the Japanese term for infectious mononucleosis . Clinical manifestations include fever, weakness, anorexia, generalized lymphadenopathy, hepatosplenomegaly, and peripheral blood mononucleosis with atypical lymphocytes . The incubation period is approximately 14 days, and no fatalities have been reported . Recent studies have identified cases in Thailand and Laos, suggesting a broader geographical distribution than initially thought .

What is Glycerol-3-phosphate acyltransferase (plsY) and its function in N. sennetsu?

Glycerol-3-phosphate acyltransferase (plsY) in N. sennetsu is an enzyme encoded by the plsY gene (NSE_0738) . It functions as an acyltransferase that catalyzes the transfer of an acyl group to glycerol-3-phosphate, a critical step in phospholipid biosynthesis . The enzyme is also known as Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, or G3P acyltransferase (GPAT) . The complete amino acid sequence of the protein contains 191 amino acids with specific structural features that contribute to its enzymatic function .

How are N. sennetsu bacteria transmitted to humans?

Transmission of N. sennetsu to humans is believed to occur through the consumption of raw fish, particularly Anabas testudineus (climbing perch), contaminated with infected trematodes (parasitic flatworms) . This transmission route has been documented in Japan and more recently confirmed in studies conducted in Laos, where N. sennetsu DNA was detected in fish samples . The bacteria are maintained in nature through vertical transmission in trematodes, creating a unique lifecycle that involves both aquatic organisms and human hosts .

What experimental approaches are used to isolate N. sennetsu from clinical samples?

Isolation of N. sennetsu from clinical samples typically involves:

  • Collection of appropriate specimens including peripheral blood buffy coats, lymph nodes, or bone marrow from suspected cases

  • Amplification using PCR targeting specific genes such as 16S rRNA, gltA, and Omp85

  • Sequence confirmation through comparison with reference sequences (e.g., N. sennetsu strain Miyayama, GenBank accession number FJ905928)

  • Real-time PCR with Taqman probes for verification and quantification

  • Serological testing using immunofluorescence assay (IFA) to detect antibodies against N. sennetsu, with titers ≥100 or seroconversion considered positive

How can recombinant N. sennetsu plsY be produced for research purposes?

Production of recombinant N. sennetsu plsY typically follows these methodological steps:

  • Gene amplification: The plsY gene (NSE_0738) is amplified from N. sennetsu genomic DNA using specific primers designed based on the known sequence.

  • Cloning: The amplified gene is inserted into an appropriate expression vector containing a suitable promoter and tag sequence (though tag type may vary depending on specific experimental requirements) .

  • Transformation: The recombinant vector is transformed into an expression host, commonly E. coli strains optimized for protein expression.

  • Expression induction: Protein expression is induced under optimized conditions considering temperature, induction agent concentration, and duration.

  • Purification: The recombinant protein is purified using affinity chromatography based on the tag incorporated into the construct.

  • Storage: The purified protein is stored in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

The expression region typically encompasses the full-length protein (amino acids 1-191) , and repeated freezing and thawing should be avoided to maintain protein integrity.

What experimental design principles should be applied when studying N. sennetsu proteins?

When designing experiments to study N. sennetsu proteins, researchers should adhere to the following principles:

  • Clear variable definition: Explicitly define independent variables (e.g., protein concentration, incubation time) and dependent variables (e.g., enzymatic activity, binding affinity) .

  • Control implementation: Include appropriate positive and negative controls to validate experimental outcomes .

  • Variable control: Identify and control confounding variables that might influence results, such as temperature fluctuations or contamination .

  • Methodological rigor: Apply standardized protocols that allow for reproducibility and comparison between different studies .

  • Statistical planning: Determine appropriate statistical approaches for data analysis before conducting experiments .

A well-designed experimental approach might examine the relationship between plsY enzymatic activity and various environmental conditions relevant to the intracellular habitat of N. sennetsu, using controlled variables and quantifiable outcomes.

What proteomics approaches have been used to identify surface-exposed proteins in N. sennetsu?

Research has identified surface-exposed proteins in N. sennetsu using sophisticated proteomics techniques:

  • Biotin surface labeling: Surface proteins are tagged with biotin to mark exposed proteins .

  • Streptavidin-affinity chromatography: Biotin-labeled proteins are isolated through their high affinity for streptavidin .

  • Liquid chromatography-tandem mass spectrometry (LC/MS/MS): This technique identified 42 out of 936 (4.5%) N. sennetsu open reading frames (ORFs), including six hypothetical proteins .

  • Immunofluorescence labeling: This technique confirmed surface exposure of proteins and revealed specific distribution patterns such as rosary-like circumferential labeling with anti-P51 antibodies and polar to diffuse punctate labeling with anti-Nsp3 antibodies .

  • Functional assays: Proteoliposome swelling assays were used to evaluate porin activity of isolated outer membrane proteins .

The data from these studies revealed that two major β-barrel proteins, the 51-kDa antigen (P51) and Neorickettsia surface protein 3 (Nsp3), are prominent surface-exposed proteins in N. sennetsu .

How does the structure and function of N. sennetsu plsY compare with plsY from other bacterial species?

CharacteristicN. sennetsu plsYOther Bacterial plsYImplications
Amino acid length191 residues Varies (170-220 residues in most bacteria)Compact functional unit adapted to obligate intracellular lifestyle
Membrane associationContains transmembrane domains with distinct hydrophobic regions Similar membrane association in most bacteriaConserved localization reflecting functional constraint
Active site motifsContains acyltransferase domainHighly conserved across bacterial speciesEssential catalytic function preserved during evolution
Substrate specificityNot fully characterizedCan vary between speciesPotential target for species-specific inhibitors
RegulationUnknown in N. sennetsuOften regulated by feedback mechanismsResearch gap requiring further investigation

The structural similarities between N. sennetsu plsY and homologs in other bacteria suggest evolutionary conservation of this essential enzyme, while differences may reflect adaptations to the unique intracellular lifestyle of Neorickettsia species .

What are the challenges in developing functional assays for N. sennetsu plsY activity?

Developing functional assays for N. sennetsu plsY activity presents several methodological challenges:

  • Obligate intracellular nature: N. sennetsu cannot be cultured axenically, requiring host cells for propagation, which complicates isolation of native proteins and establishment of in vitro systems .

  • Membrane protein properties: As a membrane-associated protein, plsY requires proper folding and lipid environment to maintain its native conformation and activity .

  • Substrate availability: Identifying and synthesizing appropriate substrates that mimic the natural acyl donors and glycerol-3-phosphate acceptors with suitable modifications for detection.

  • Detection systems: Establishing sensitive and specific detection methods for the products of the acyltransferase reaction.

  • Assay conditions: Determining optimal pH, ionic strength, and cofactor requirements that reflect the intracellular environment where the enzyme naturally functions.

A successful approach might involve reconstitution of purified recombinant plsY into proteoliposomes to provide a membrane-like environment, similar to methods used for studying the porin activity of P51 .

How can structural studies of N. sennetsu plsY inform potential inhibitor design for therapeutic applications?

Structural studies of N. sennetsu plsY could inform inhibitor design through several avenues:

  • Active site mapping: Detailed characterization of the catalytic site architecture would identify critical residues involved in substrate binding and catalysis.

  • Allosteric site identification: Structural analysis might reveal allosteric sites that could be targeted to modulate enzyme activity indirectly.

  • Structure-based virtual screening: Computational approaches using the solved structure could screen virtual libraries for compounds predicted to bind and inhibit the enzyme.

  • Fragment-based drug design: Identification of small molecular fragments that bind to different regions of the protein could lead to the development of more complex inhibitors.

  • Comparative structural analysis: Comparing the structure of N. sennetsu plsY with human homologs could identify structural differences to exploit for selective inhibition.

The development of such inhibitors could potentially lead to new therapeutic approaches for Sennetsu neorickettsiosis, particularly valuable given the disease's transmission through raw fish consumption in endemic areas .

What is the role of plsY in the pathogenesis of N. sennetsu infection?

While the specific role of plsY in N. sennetsu pathogenesis is not fully characterized, several hypotheses can be proposed based on current understanding:

  • Membrane biogenesis: As an enzyme involved in phospholipid biosynthesis, plsY likely plays a critical role in bacterial membrane formation and integrity, essential for survival within host cells .

  • Adaptation to intracellular environment: Phospholipid composition influences membrane fluidity and permeability, potentially helping N. sennetsu adapt to the intracellular environment of monocytes and macrophages .

  • Interaction with host membranes: Bacterial phospholipids may influence interactions with host cell membranes during infection and intracellular trafficking.

  • Metabolic integration: PlsY activity may be integrated with host cell metabolism to acquire necessary precursors for phospholipid synthesis.

  • Immune evasion: Membrane composition could affect recognition by host immune system components.

Research approaches to investigate these hypotheses might include gene knockout or knockdown studies (challenging in obligate intracellular organisms), inhibitor studies, or comparative genomics analyzing plsY sequence conservation among different isolates with varying virulence.

What serological methods are available for detecting N. sennetsu infection in research and clinical settings?

Several serological approaches have been validated for detecting N. sennetsu infection:

  • Immunofluorescence assay (IFA): This method detects antibodies against N. sennetsu, with reciprocal IgG antibody titers ≥100 or seroconversion considered positive . Studies in Laos found a high prevalence (17%) of IFA IgG anti-N. sennetsu antibodies compared with 4% and 0% from febrile patients in Thailand and Malaysia, respectively .

  • Western blot analysis: This technique provides more specific detection of antibodies against particular N. sennetsu proteins, similar to methods used for other rickettsiae .

  • ELISA: Enzyme-linked immunosorbent assays using recombinant N. sennetsu proteins, including potentially plsY, can be developed for more standardized antibody detection .

  • Indirect immunofluorescence: This method can be used to visualize N. sennetsu bacteria in clinical samples or experimental systems using specific antibodies .

These serological methods complement molecular approaches such as PCR amplification of the 16S rRNA, gltA, and Omp85 genes, which provide direct detection of the bacterium .

How can researchers effectively design experiments to study plsY function in the context of N. sennetsu biology?

An effective experimental design for studying plsY function in N. sennetsu should incorporate:

Following rigorous experimental design principles will ensure that variables are properly controlled and that results are both reliable and reproducible .

What emerging technologies might advance our understanding of N. sennetsu plsY function?

Several cutting-edge technologies hold promise for advancing research on N. sennetsu plsY:

  • Cryo-electron microscopy: This technique could provide high-resolution structural information about plsY in its native membrane environment, overcoming challenges associated with crystallizing membrane proteins.

  • Single-cell analysis technologies: These methods could examine the role of plsY in individual bacteria within infected host cells, potentially revealing heterogeneity in expression or function.

  • CRISPR interference systems: Modified for use in obligate intracellular bacteria, these could allow for targeted gene repression to study plsY function without complete gene deletion.

  • Synthetic biology approaches: Creating minimal systems that express plsY in surrogate hosts might allow for functional studies outside the constraints of working with an obligate intracellular pathogen.

  • Advanced computational modeling: Molecular dynamics simulations could predict how plsY interacts with substrates and potential inhibitors, guiding experimental design.

These technologies could overcome many of the current limitations in studying proteins from obligate intracellular bacteria like N. sennetsu.

How might the study of N. sennetsu plsY contribute to broader understanding of bacterial phospholipid biosynthesis?

The study of N. sennetsu plsY offers unique insights into bacterial phospholipid biosynthesis:

  • Evolutionary adaptations: As an obligate intracellular bacterium, N. sennetsu may have evolved specialized features in its phospholipid biosynthesis pathways that reflect adaptation to its niche within host cells .

  • Minimal systems: The reduced genome of N. sennetsu (936 ORFs identified) suggests it maintains only essential pathways, potentially offering a simplified model for studying core aspects of bacterial phospholipid biosynthesis.

  • Host-pathogen interface: Understanding how N. sennetsu coordinates its phospholipid synthesis with available host resources could reveal fundamental principles about metabolic integration during intracellular infection.

  • Comparative biochemistry: Differences between plsY from N. sennetsu and those from free-living bacteria might highlight aspects of enzyme function that have been shaped by different selective pressures.

  • Drug target validation: Studies of N. sennetsu plsY could validate the broader potential of bacterial phospholipid biosynthesis as an antibacterial target class, particularly for intracellular pathogens.

These contributions would extend beyond Neorickettsia to inform our understanding of bacterial phospholipid biosynthesis across diverse bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.