Recombinant Neorickettsia sennetsu NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Neorickettsia sennetsu NADH-Quinone Oxidoreductase Subunit A (nuoA)

Recombinant Neorickettsia sennetsu nuoA is a bacterial membrane protein expressed as part of the NADH:quinone oxidoreductase (Complex I) in the respiratory chain. It is a core subunit critical for electron transfer and proton translocation . The protein is produced via recombinant expression in E. coli, with a His-tag for purification and a full-length sequence spanning 1–130 amino acids (AA) .

Expression and Purification

Recombinant nuoA is produced in E. coli with an N-terminal His-tag for affinity chromatography. Key steps include:

  1. Expression: Induced in E. coli under optimized conditions.

  2. Purification: Nickel-based affinity chromatography followed by size-exclusion chromatography.

  3. Reconstitution: Lyophilized protein is rehydrated in deionized water with 5–50% glycerol for stability .

Research and Diagnostic Applications

  • Antigen for ELISA: Used in serological assays to detect N. sennetsu infections, which cause mononucleosis-like illnesses linked to raw fish consumption .

  • Structural Studies: Investigates Complex I assembly and proton translocation mechanisms .

  • Vaccine Development: Potential target in bacterial pathogenicity studies .

Comparative Analysis of Recombinant Proteins

ParameternuoA (Q2GDY1) TSAD (Q2GEG6)
Protein Length130 AA329 AA
FunctionNADH-quinone oxidoreductaseHypothetical function
Expression HostE. coliE. coli
Purity>90%>85%
Key ApplicationImmunological assaysResearch (e.g., Western blot)

Revised Transmembrane Orientation

Contrary to earlier models, cytoplasmic localization of the C-terminal domain in E. coli nuoA suggests a distinct topology compared to homologs like Paracoccus denitrificans NQO7 . This challenges previous assumptions about Complex I subunit organization.

Disease Association

Neorickettsia sennetsu infections are linked to high seroprevalence in Laos, with nuoA serving as a diagnostic marker . PCR studies confirm its presence in fish (Anabas testudineus), highlighting zoonotic transmission risks .

Enzymatic Activity

While nuoA itself lacks catalytic activity, it interacts with FMN and Fe-S clusters in Complex I to shuttle electrons and generate proton gradients . Structural studies emphasize its role in stabilizing the enzyme’s architecture .

Challenges and Future Directions

  1. Stability: Repeated freeze-thaw cycles degrade the protein, necessitating strict storage protocols .

  2. Functional Elucidation: Further studies are needed to resolve nuoA’s precise role in Complex I dynamics.

  3. Diagnostic Utility: Optimizing ELISA sensitivity for N. sennetsu detection in endemic regions remains critical .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoA; NSE_0429; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama) (Ehrlichia sennetsu)
Target Names
nuoA
Target Protein Sequence
MLESSVVGIGKWVVEDYIFVGLFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDK LSSTGERFNVRFYLVGILFIIFDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVY EFVSGALDWR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is considered the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus harnessing the redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Neorickettsia sennetsu NADH-quinone oxidoreductase subunit A?

Neorickettsia sennetsu NADH-quinone oxidoreductase subunit A (nuoA) is a 130-amino acid protein component of the NADH dehydrogenase I complex, which plays a critical role in the electron transport chain of this obligate intracellular bacterium. The protein features a full-length sequence from positions 1-130 with UniProt ID Q2GDY1. Its amino acid sequence is: MLESSVVGIGKWVVEDYIFVGLFFVVACFISCVMLALPVFIAPSSHERHKGDSYECGFDKLSSTGERFNVRFYLVGILFIIFDLEIIFLFPWAVSARELGPAAFVSVLIFLIILTVGFVYEFVSGALDWR . The protein functions as part of the membrane-bound respiratory complex that catalyzes the transfer of electrons from NADH to quinones, contributing to the establishment of a proton gradient essential for ATP synthesis.

How does nuoA contribute to the pathogenesis of Neorickettsia sennetsu?

As a component of the electron transport chain, nuoA likely plays a significant role in energy metabolism of Neorickettsia sennetsu, which is essential for bacterial survival within host monocytes and macrophages. Neorickettsia sennetsu is the etiologic agent of human Sennetsu neorickettsiosis . While direct evidence specifically linking nuoA to pathogenesis is limited in the current literature, research on similar bacterial respiratory complexes suggests that electron transport chain components are critical for intracellular survival and can influence virulence. The protein's membrane association may also position it as potentially accessible to host immune recognition, making it relevant to host-pathogen interaction studies.

What expression systems have been successfully used for recombinant nuoA production?

Recombinant Neorickettsia sennetsu nuoA has been successfully expressed in Escherichia coli with an N-terminal His tag fusion . This prokaryotic expression system has proven effective for producing the protein in sufficient quantities for biochemical and structural studies. The His-tag facilitates purification via metal affinity chromatography while minimizing interference with the protein's native structure and function. Alternative expression systems such as insect cells or cell-free systems may be considered for specific research applications, though published data regarding their use with nuoA specifically is currently limited.

What are the optimal conditions for expressing and purifying recombinant nuoA?

For optimal expression and purification of recombinant nuoA, the following methodological approach is recommended:

  • Expression in E. coli using a compatible vector containing an N-terminal His tag

  • Induction optimization with varying IPTG concentrations (0.1-1.0 mM) and temperatures (16-37°C)

  • Purification via nickel-affinity chromatography using a linear imidazole gradient

  • Buffer optimization to maintain protein stability (typically Tris/PBS-based buffer, pH 8.0)

  • Addition of 6% trehalose as a stabilizing agent

  • Final purification step via size exclusion chromatography

The purified protein should achieve >90% purity as determined by SDS-PAGE . For long-term storage, aliquoting with 5-50% glycerol (final concentration) and storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles that can compromise protein integrity.

What surface labeling techniques are most effective for studying nuoA localization?

For investigating the surface exposure and localization of nuoA in Neorickettsia sennetsu, biotin surface labeling followed by streptavidin-affinity chromatography has proven effective . This approach allows for the specific isolation of surface-exposed proteins, with subsequent identification using liquid chromatography-tandem mass spectrometry (LC-MS/MS). The technique involves:

  • Gentle biotinylation of intact bacteria using membrane-impermeable reagents

  • Cell lysis under controlled conditions

  • Affinity purification of biotinylated proteins

  • LC-MS/MS analysis for protein identification

This methodology has successfully identified surface-exposed proteins in Neorickettsia, with 42 out of 936 (4.5%) N. sennetsu open reading frames detected . When applying this technique, it's critical to maintain bacterial integrity prior to biotinylation to ensure specific labeling of only surface-exposed proteins.

How can researchers overcome solubility challenges with recombinant nuoA?

As a membrane-associated protein, nuoA presents solubility challenges common to many hydrophobic proteins. To address these challenges:

  • Optimize detergent selection: Screen mild detergents (DDM, LDAO, or C12E8) at concentrations just above their critical micelle concentration

  • Consider fusion tags: Beyond the His-tag, solubility-enhancing tags like SUMO or MBP may improve expression and solubility

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES may facilitate proper folding

  • Implement refolding protocols: If inclusion bodies form, develop a refolding strategy using step-wise dialysis

  • Buffer optimization: Include glycerol (5-10%) and appropriate salt concentrations (typically 150-300 mM NaCl)

When reconstituting lyophilized nuoA protein, it's recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL before adding stabilizing agents like glycerol .

How can structural biology approaches be applied to study nuoA function?

Structural characterization of nuoA can provide valuable insights into its function and potential as a therapeutic target. Consider the following approaches:

  • X-ray crystallography: Requires high-purity protein crystals, challenging for membrane proteins but offering high-resolution data

  • Cryo-electron microscopy: Increasingly valuable for membrane proteins, potentially allowing visualization of nuoA within the larger NADH dehydrogenase complex

  • NMR spectroscopy: Suitable for dynamic studies of smaller protein domains

  • Molecular dynamics simulations: Can provide insights into conformational changes using the known amino acid sequence

  • Homology modeling: Constructing models based on structural homologs when experimental structures are unavailable

To facilitate structural studies, researchers should optimize protein stability and homogeneity, potentially exploring nanodiscs or amphipol systems to maintain the native-like membrane environment.

What are the recommended approaches for investigating nuoA interactions with other respiratory complex subunits?

Investigating protein-protein interactions within the respiratory complex requires specialized approaches:

  • Co-immunoprecipitation: Using antibodies against nuoA or interaction partners

  • Proximity labeling: BioID or APEX2 fusion proteins to identify proximal proteins in situ

  • Cross-linking coupled with mass spectrometry: To capture transient interactions

  • Yeast two-hybrid or bacterial two-hybrid assays: For identifying direct interactions

  • Blue Native PAGE: For preserving native protein complexes during electrophoretic separation

These approaches can help elucidate how nuoA interacts with other subunits of the NADH-quinone oxidoreductase complex and potentially identify novel interaction partners that might be relevant to Neorickettsia sennetsu pathogenesis.

How can researchers effectively analyze nuoA enzymatic activity in the context of the complete NADH dehydrogenase complex?

Analyzing nuoA enzymatic activity presents challenges due to its function as part of a multi-subunit complex. Consider these methodological approaches:

  • Reconstitution experiments: Incorporating purified nuoA into liposomes with other complex components

  • NADH oxidation assays: Spectrophotometric monitoring of NADH consumption (Δ340nm)

  • Electron transfer measurements: Using artificial electron acceptors

  • Membrane potential measurements: Using fluorescent probes to assess proton pumping activity

  • Site-directed mutagenesis: To identify critical residues for function

When designing these experiments, researchers should consider the following parameters for data collection and analysis:

What are common pitfalls in recombinant nuoA protein stability and how can they be addressed?

Researchers often encounter stability issues with recombinant nuoA. These challenges and their solutions include:

  • Protein aggregation

    • Add stabilizing agents such as trehalose (6%)

    • Optimize buffer conditions (ionic strength, pH)

    • Include appropriate detergents at concentrations above CMC but below protein destabilization thresholds

  • Proteolytic degradation

    • Include protease inhibitors during purification

    • Optimize expression conditions to minimize proteolysis

    • Design constructs to exclude flexible regions prone to proteolysis

  • Activity loss during storage

    • Aliquot and store at -80°C to prevent freeze-thaw cycles

    • Add glycerol (5-50%) as cryoprotectant

    • Consider flash-freezing in liquid nitrogen

  • Oxidation of critical residues

    • Include reducing agents like DTT or TCEP

    • Perform purification steps under nitrogen atmosphere when possible

    • Consider point mutations of non-essential cysteines

Implement quality control checkpoints at each stage of purification, using techniques such as dynamic light scattering to monitor aggregation state and thermal shift assays to assess stability under different buffer conditions.

How should researchers approach contradictory data regarding nuoA localization or function?

When confronted with contradictory data regarding nuoA localization or function, follow this systematic approach:

  • Methodological assessment:

    • Evaluate differences in experimental techniques (e.g., different surface labeling methods)

    • Compare protein preparation methods (detergent types, purification approaches)

    • Assess expression systems used (prokaryotic vs. eukaryotic)

  • Biological context evaluation:

    • Consider strain differences in Neorickettsia sennetsu

    • Evaluate host cell effects if studies used different host systems

    • Assess growth conditions and life cycle stages

  • Statistical and technical validation:

    • Re-examine criteria for positive identification in proteomics studies

    • Evaluate technical replicates and statistical analyses

    • Consider false discovery rates in high-throughput approaches

  • Reconciliation strategies:

    • Design experiments that directly address contradictions

    • Implement multiple complementary approaches to test the same hypothesis

    • Consider conditional or environment-dependent behaviors

Remember that differences in data may reflect genuine biological complexity rather than experimental error. The location and function of nuoA may be dynamic, responding to changes in bacterial physiology or host cell environment.

What quality control metrics should be applied to nuoA functional assays?

To ensure reliability of nuoA functional assays, implement these quality control metrics:

  • Protein quality assessment:

    • Purity >90% by SDS-PAGE

    • Monodispersity by DLS

    • Thermal stability by differential scanning fluorimetry

    • Structural integrity by circular dichroism

  • Assay validation parameters:

    • Signal-to-noise ratio >10:1

    • Z-factor >0.5 for high-throughput assays

    • Coefficient of variation <15% between technical replicates

    • Appropriate positive and negative controls

  • Data analysis standards:

    • Clear statistical justification for sample sizes

    • Appropriate normalization methods

    • Curve fitting with defined constraints

    • Reporting of goodness-of-fit parameters

  • Reproducibility measures:

    • Independent protein preparations

    • Different experimentalists

    • Inter-laboratory validation when possible

    • Multiple detection methods where applicable

These metrics ensure that functional data are robust and reproducible, facilitating reliable interpretation and comparison across studies.

How might nuoA be exploited as a potential therapeutic target against Neorickettsia infections?

Exploring nuoA as a therapeutic target builds upon its essential role in bacterial energy metabolism. Consider these research approaches:

  • Structure-based drug design:

    • Identify druggable pockets within nuoA structure

    • Virtual screening against these targets

    • Fragment-based approaches to develop high-affinity inhibitors

  • Mechanism-based inhibition:

    • Design compounds that disrupt electron transfer

    • Target nuoA-specific residues not conserved in host homologs

    • Explore allosteric inhibition mechanisms

  • Validation approaches:

    • Genetic validation through conditional knockdowns

    • Phenotypic assays to confirm essentiality

    • Host cell infection models to assess efficacy

  • Delivery strategies:

    • Develop penetration mechanisms for reaching intracellular bacteria

    • Explore host-directed therapies that might indirectly compromise nuoA function

    • Consider combination approaches with existing antibiotics

This emerging area requires interdisciplinary collaboration between structural biologists, medicinal chemists, and infectious disease specialists to translate fundamental insights into therapeutic applications.

What comparative genomics approaches can elucidate nuoA evolution across bacterial species?

Comparative genomics provides valuable insights into nuoA evolution and potential specialized functions:

  • Sequence conservation analysis:

    • Multiple sequence alignments across diverse bacterial species

    • Identification of universally conserved vs. Neorickettsia-specific residues

    • Positive selection analysis to identify adaptively evolving sites

  • Structural comparison strategies:

    • Homology modeling based on structures from model organisms

    • Conservation mapping onto predicted structural models

    • Analysis of co-evolving residue networks

  • Genomic context examination:

    • Operon structure comparison across species

    • Analysis of regulatory elements

    • Horizontal gene transfer assessment

  • Functional prediction approaches:

    • Integration of sequence, structure, and genomic context data

    • Prediction of substrate specificity differences

    • Identification of potential adaptations to host environments

These approaches can reveal how nuoA has evolved in Neorickettsia sennetsu compared to free-living bacteria, potentially illuminating adaptations for intracellular survival and pathogenesis.

How can systems biology approaches integrate nuoA function into broader metabolic networks of Neorickettsia sennetsu?

Systems biology offers powerful frameworks for understanding nuoA's role within the broader context of bacterial metabolism:

  • Metabolic network reconstruction:

    • Integration of nuoA into genome-scale metabolic models

    • Flux balance analysis to predict metabolic consequences of nuoA perturbation

    • Identification of synthetic lethal interactions

  • Multi-omics integration:

    • Correlation of nuoA expression with transcriptomic, proteomic, and metabolomic data

    • Network analysis to identify functional modules

    • Identification of condition-specific regulatory mechanisms

  • Host-pathogen interaction modeling:

    • Simulation of energy metabolism during different infection stages

    • Prediction of metabolic vulnerabilities during host cell adaptation

    • Integration with host cell metabolic models

  • Experimental validation approaches:

    • Targeted metabolomics to validate predicted flux changes

    • Genetic interaction screens to test network predictions

    • Isotope labeling experiments to track electron flow

This systems-level understanding could reveal non-obvious therapeutic targets and provide insights into how Neorickettsia sennetsu adapts its energy metabolism during different stages of infection and in response to host defense mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.