Recombinant Neosartorya fischeri Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Functional Role of FCJ1

FCJ1 is a mitochondrial inner membrane protein critical for forming crista junctions (CJs)—tubular structures connecting the inner boundary membrane to cristae membranes . In yeast (S. cerevisiae), FCJ1 (also called MIC60/mitofilin) regulates cristae morphology by modulating the oligomerization state of F1FO-ATP synthase . Key functions include:

  • Cristae Junction Formation: Deletion of FCJ1 eliminates CJs, causing stacked inner membrane structures .

  • Membrane Curvature Modulation: FCJ1 antagonizes F1FO-ATP synthase subunits e/g to control cristae tip formation and branching .

  • Interaction with TOB/SAM Complex: The C-terminal domain of FCJ1 binds the TOB/SAM complex, linking cristae biogenesis to outer membrane β-barrel protein assembly .

Recombinant FCJ1 Production

Recombinant FCJ1 proteins from related species have been characterized:

Saccharomyces cerevisiae FCJ1

  • Expression System: Produced in E. coli with an N-terminal His tag .

  • Protein Details:

    • Length: 523 amino acids (residues 18–540) .

    • Sequence Features: Includes conserved domains for membrane curvature regulation and TOB/SAM binding .

    • Purity: >90% by SDS-PAGE .

ParameterValue
UniProt IDP36112
Molecular Weight~60 kDa
Storage-20°C/-80°C in Tris/PBS buffer
ApplicationsStructural and functional studies

Neosartorya fumigata FCJ1

A recombinant version (MBS7014677) is commercially available, though detailed characterization data remain unpublished .

Research Implications

FCJ1’s role in mitochondrial architecture has broad implications:

  • Disease Models: Dysfunctional cristae are linked to neurodegenerative disorders and metabolic diseases.

  • Antifungal Targets: While N. fischeri is better known for antifungal proteins (NFAPs) , FCJ1 homologs in pathogenic fungi (e.g., Aspergillus spp.) could inform antifungal drug development.

Gaps and Future Directions

  • No peer-reviewed studies specifically address N. fischeri FCJ1. Current knowledge relies on yeast and N. fumigata homologs.

  • Structural studies (e.g., cryo-EM) are needed to resolve FCJ1’s interaction networks in fungal mitochondria.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC60; NFIA_108170; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-624
Protein Length
Full Length of Mature Protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
MIC60
Target Protein Sequence
ADAKPPVTGAPTPASPSSESPIPPESVPKPSPAAEAPPPPPPPPAPARKTGRFRKFLLYL ILTSGFAYGGGIFLALKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNQNRAPK DEGHTVTIPSKSGLSWKVADEESGADVSQKGPHMSALDNGEKAQLKPGAAKPEEKVAAVE KAKAESAAKEQSSDDKKKVQEEPKKPAAPAVTPIEFATVSEGDEEVVQELVKTFNDIITV IGADENAHKFSGAVNKAKEELRTIGEKIIAIRNEARNAAQEEIKQAHATFDESARELIRR FEEARAHDAAQYREEFEVERERLARAYQEKVNTELQRAQEVAEQRLKNELVEQAIELNRK YLHEVKDLVEREREGRLSKLNELTANVNLLEKLTTDWKEVIDTNLKTQQLQVAVDAVRSV LERSTVPRPFVRELVAVKELAAGDPVVEAAIASINPTAYQRGIPSTSQIIERFRRVADEV RKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESVLLRTEHLLEEGNLDDAAREM NTLKGWAKILSKDWLSDVRRVLEVKQALEVIETEARLQCLRVE
Uniprot No.

Target Background

Function

Recombinant Neosartorya fischeri Formation of Crista Junctions protein 1 (FCJ1) is a component of the Mitochondrial Contact Site and Cristae Organizing System (MICOS) complex. This large protein complex, located within the inner mitochondrial membrane, plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating contact site formation with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane. Additionally, it facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Neosartorya fischeri and what is its clinical significance?

Neosartorya fischeri is a fungal pathogen related to but distinct from Aspergillus fumigatus. This organism has significant clinical relevance as it can cause invasive fungal infections, particularly in immunocompromised patients. The first documented case of N. fischeri infection in an allogeneic bone marrow transplant (BMT) recipient demonstrated its pathogenicity despite aggressive antifungal therapy with amphotericin B. The patient ultimately succumbed to overwhelming fungal infection on day 60 post-BMT .

N. fischeri presents diagnostic challenges due to its slow growth in culture, which can delay or confuse identification. This characteristic underscores the importance of developing more effective detection methods, particularly in clinical settings where timely diagnosis is crucial. The emergence of this pathogen highlights the need for more effective prophylaxis and treatment strategies for non-Candida fungal infections in allogeneic BMT populations .

What is FCJ1 and what role does it play in mitochondrial structure?

FCJ1 (Formation of Crista Junctions protein 1) is a mitochondrial inner membrane protein that plays a critical role in determining mitochondrial ultrastructure, particularly in the formation and maintenance of crista junctions (CJs). CJs are tubular invaginations of the inner membrane that connect the inner boundary membrane with the cristae membrane, forming architectural elements essential for mitochondrial function .

FCJ1 is specifically enriched at CJs and modulates their formation in an antagonistic manner to subunits e and g of the F1FO ATP synthase. Cells lacking FCJ1 demonstrate a complete absence of CJs and exhibit concentric stacks of inner membrane in the mitochondrial matrix. Conversely, overexpression of FCJ1 leads to increased CJ formation, branching of cristae, and enlargement of CJ diameter .

The protein interacts with multiple components in the mitochondrial membranes, including the TOB/SAM complex in the outer membrane, which suggests a role in anchoring CJs to the outer membrane and stabilizing their position. This interaction is particularly important for maintaining the typical architecture of mitochondria, where CJs are located almost exclusively at sites where cristae meet the inner boundary membrane .

What are the key domains of FCJ1 and their functions?

FCJ1 contains several distinct domains with specific functions in mitochondrial membrane organization:

  • N-terminal Domain and Transmembrane Segment: The N-terminal region contains a mitochondrial targeting sequence and a transmembrane segment that anchors FCJ1 to the inner membrane. While anchoring to the inner membrane is functionally important, the specific amino acid sequence of the transmembrane segment is not critical. Variants with altered transmembrane segments (e.g., Fcj1 Dld1-TM) can fully rescue growth defects in Δfcj1 strains .

  • Coiled-coil Domain (residues 166-342): This domain is crucial for the formation of stable CJs. Deletion of this domain leads to impaired mitochondrial function, with cells showing incomplete growth suppression on non-fermentable carbon sources and altered mitochondrial morphology. The coiled-coil domain likely facilitates protein-protein interactions important for CJ formation .

  • C-terminal Domain: The most conserved part of FCJ1, this domain is essential for FCJ1 function. In its absence, formation of CJs is strongly impaired, and irregular, stacked cristae are present. The C-terminal domain mediates:

    • Interaction with full-length FCJ1, suggesting a role in oligomer formation

    • Interaction with Tob55 of the TOB/SAM complex, enabling connection to the outer membrane

    • Genetic interaction with subunit e of the F1FO ATP synthase

DomainResiduesKey FunctionsEffect of Deletion
N-terminal/TM1-165Mitochondrial targeting; membrane anchoringLoss of mitochondrial localization; dominant-negative effects
Coiled-coil166-342Formation of stable CJsImpaired CJ formation; incomplete growth rescue
C-terminal343-540Oligomerization; TOB/SAM complex interactionStrong impairment of CJ formation; stacked cristae; loss of genetic interaction with F1FO ATP synthase

How does FCJ1 interact with other mitochondrial proteins?

FCJ1 engages in multiple protein-protein interactions that are critical for its function in maintaining mitochondrial architecture:

  • Self-interaction: FCJ1 interacts with full-length FCJ1, primarily through its C-terminal domain, suggesting the formation of homo-oligomeric complexes that may be important for stabilizing CJ structure .

  • TOB/SAM Complex: The C-terminal domain of FCJ1 interacts with Tob55, a component of the translocase of outer membrane β-barrel proteins (TOB)/sorting and assembly machinery (SAM) complex. This interaction appears to anchor CJs to the outer membrane, explaining why CJs are typically located where cristae meet the inner boundary membrane. The association of the TOB/SAM complex with contact sites depends on FCJ1 presence .

  • F1FO ATP Synthase: FCJ1 genetically interacts with subunits e and g of the F1FO ATP synthase. This interaction is mediated by the C-terminal domain of FCJ1. Notably, FCJ1 and subunits e/g have antagonistic effects on cristae architecture. While FCJ1 promotes CJ formation, subunits e/g promote the formation of cristae tips through oligomerization of the F1FO ATP synthase .

  • MICOS/MINOS/MitOS Complex: FCJ1 was identified as a component of a large multisubunit complex (MICOS/MINOS/MitOS) that plays a central role in the formation of CJs and in determining cristae morphology .

How can researchers experimentally determine FCJ1 localization in mitochondria?

Precise localization of FCJ1 within mitochondrial subdomains requires multiple complementary approaches:

  • Immunogold Electron Microscopy: This technique provides the highest resolution for determining the precise localization of FCJ1 within mitochondrial subcompartments. The methodology involves:

    • Chemical fixation of cells followed by cryosectioning

    • Immunodecoration with FCJ1-specific antibodies at low concentrations to minimize non-specific binding

    • Visualization using gold particle-conjugated secondary antibodies

    • Quantitative analysis by projecting gold particles onto a mitochondrial model

    • Statistical analysis of gold particle distribution using a sliding window approach to count particles within 14-nm distance from the inner membrane

  • Comparative Distribution Analysis: For robust localization data, compare FCJ1 distribution with controls such as:

    • Cox2 (cytochrome c oxidase subunit), which is enriched in cristae membranes

    • Subunits e and g of F1FO ATP synthase, which are enriched at cristae tips

  • Verification of Antibody Specificity: Always confirm antibody specificity through:

    • Western blotting comparing wild-type and Δfcj1 strains

    • Immunogold labeling of wild-type and Δfcj1 cells

Using these approaches, researchers have determined that FCJ1 is most highly concentrated at crista junctions, with significantly lower levels in other parts of the inner membrane, supporting its role in CJ formation and maintenance.

What techniques are most effective for studying the effects of FCJ1 on cristae morphology?

Studying how FCJ1 affects cristae morphology requires techniques that can visualize mitochondrial ultrastructure with high resolution:

  • Electron Tomography: This technique provides detailed 3D visualization of mitochondrial membranes:

    • Prepare samples through chemical fixation of cells

    • Collect tilt series of images using transmission electron microscopy

    • Computationally reconstruct 3D volume

    • Analyze resulting tomograms for features such as CJs, cristae branching, and membrane arrangements

  • Quantitative Analysis of Mitochondrial Features: To objectively assess morphological changes:

    • Count the number of CJs per mitochondrial section

    • Measure CJ diameter

    • Count cristae tips

    • Assess the degree of cristae branching

    • Compare these metrics across different genetic backgrounds (wild-type, Δfcj1, FCJ1 overexpression, domain deletions)

  • Genetic Manipulation Approaches:

    • Gene deletion: Compare Δfcj1 strains to wild-type

    • Controlled expression: Use doxycycline-repressible promoters for titrated overexpression

    • Domain deletion/mutation: Express variants lacking specific domains to determine their contribution to function

    • Double mutants: Combine FCJ1 manipulation with deletion of F1FO ATP synthase subunits e/g to study their antagonistic relationship

By combining these approaches, researchers can comprehensively assess how FCJ1 influences cristae architecture and CJ formation under various conditions.

How can structural arrangements of F1FO ATP synthase be visualized in relation to FCJ1 function?

The structural arrangement of F1FO ATP synthase complexes in mitochondria and their relationship to FCJ1 function can be visualized using specialized EM techniques:

  • Freeze-Fracture Electron Microscopy:

    • This technique exposes the inner surface of mitochondrial membranes

    • In Δfcj1 mitochondria, it reveals regular arrangements of F1 particles in zipperlike structures with square-like or hexagonal patterns

    • These structures correspond to F1FO ATP synthase oligomers with dimensions of approximately 10 × 10 × 10 nm

  • Nearest Neighbor Distance Analysis:

    • Measure the distances between F1 particles and their respective nearest neighbors

    • In Δfcj1 mitochondria, the majority of distances fall between 14-16 nm, indicating ordered arrangement

    • In control strains lacking F1FO oligomerization capacity (Δfcj1/Δsug), a random distribution with a broad range of distances is observed

  • Comparative Analysis Across Genetic Backgrounds:

    • Wild-type mitochondria: F1FO supercomplexes are typically not observable in intact mitochondria due to high protein density in the matrix

    • Δfcj1 mitochondria: Show zipperlike arrangements of F1FO

    • Δfcj1/Δsue or Δfcj1/Δsug mitochondria: Show random distribution of F1 particles

These approaches allow researchers to correlate the presence/absence of FCJ1 with specific organizational patterns of F1FO ATP synthase complexes, providing insight into how these proteins antagonistically regulate mitochondrial membrane architecture.

How does FCJ1 domain architecture contribute to its function in CJ formation?

The functional contribution of each FCJ1 domain can be systematically assessed through domain deletion and substitution studies:

  • Transmembrane Domain Analysis:

    • Standard approach: Generate variants where the native transmembrane domain is replaced with alternative sequences (e.g., Fcj1Dld1-TM) or deleted entirely

    • Functional assessment: Evaluate growth on fermentable (SD) and non-fermentable (SLac) carbon sources

    • Findings: While the specific sequence of the transmembrane segment is not critical (Fcj1Dld1-TM fully rescues growth), anchoring to the inner membrane is essential (cytosolic variants show dominant-negative effects)

  • Coiled-Coil Domain Assessment:

    • Generate deletion variants lacking residues 166-342 (Fcj1Δ166-342His)

    • Evaluate growth patterns in liquid and solid media

    • Measure the percentage of respiratory-deficient cells

    • Examine mitochondrial morphology via fluorescence microscopy

    • Results: The coiled-coil domain is crucial for full functionality, with deletion leading to incomplete growth suppression and altered mitochondrial morphology

  • C-Terminal Domain Evaluation:

    • Create truncation variants lacking the C-terminal domain (e.g., Fcj1 1-472)

    • Test genetic interactions with F1FO ATP synthase subunits

    • Analyze cristae morphology via electron microscopy

    • Results: The C-terminal domain is essential for FCJ1 function in CJ formation and for genetic interaction with F1FO ATP synthase

A comprehensive experimental design would include:

VariantConstructionGrowth AssaysMorphology AnalysisProtein Interaction Studies
Wild-type Fcj1Full-length with His tagGrowth curves, spot testsFluorescence and EMCo-IP, pull-down assays
Fcj1Dld1-TMReplace TM with Dld1 TMCompare to WTAssess mitochondrial networksVerify membrane insertion
Fcj1Δ166-342HisDelete coiled-coil domainQuantify growth defectCristae architecture analysisTest oligomerization
Fcj1 1-472Remove C-terminusTest dominant effectsEvaluate CJ presenceExamine TOB/SAM interaction

Through systematic analysis of these variants, researchers can establish structure-function relationships for each FCJ1 domain and their relative contributions to CJ formation.

What is the molecular mechanism by which FCJ1 and F1FO ATP synthase antagonistically control cristae architecture?

The antagonistic relationship between FCJ1 and F1FO ATP synthase subunits e and g in controlling cristae architecture involves several interconnected mechanisms:

This antagonistic control mechanism provides a dynamic system for regulating mitochondrial inner membrane architecture, allowing adaptation to different physiological conditions and energy requirements.

How does the interaction between FCJ1 and the TOB/SAM complex influence crista junction formation?

The interaction between FCJ1 and the TOB/SAM complex represents a critical link between the mitochondrial inner and outer membranes that influences CJ formation:

  • Molecular Basis of the Interaction:

    • The C-terminal domain of FCJ1 physically interacts with Tob55, a core component of the TOB/SAM complex

    • This interaction is mediated specifically by the conserved C-terminal region of FCJ1

    • The association of the TOB/SAM complex with contact sites between inner and outer membranes depends on FCJ1 presence

  • Functional Consequences:

    • This interaction helps position and stabilize CJs close to the outer membrane

    • Down-regulation of the TOB/SAM complex leads to altered cristae morphology and moderate reduction in CJ numbers

    • The FCJ1-TOB/SAM interaction may explain why CJs are located almost exclusively at sites where cristae meet the inner boundary membrane

  • Experimental Evidence:

    • Co-immunoprecipitation studies demonstrate physical interaction between FCJ1 and Tob55

    • Deletion of FCJ1's C-terminal domain abolishes this interaction

    • Mutations affecting the TOB/SAM complex alter cristae morphology independently of effects on β-barrel protein biogenesis

  • Mechanistic Model:

    • FCJ1 serves as an anchor that connects CJs to the outer membrane via the TOB/SAM complex

    • This anchoring prevents the formation of CJ-like structures internally within cristae membranes

    • The interaction constrains the location of CJs to regions near the outer membrane

    • This spatial organization may facilitate communication between the inner and outer membranes and optimize mitochondrial function

This interaction reveals a novel function for the TOB/SAM complex beyond its established role in β-barrel protein insertion, highlighting the complex interplay between different mitochondrial protein complexes in maintaining organelle architecture.

How can researchers address inconsistencies in quantifying CJ formation in FCJ1 studies?

Quantifying CJ formation presents several methodological challenges that researchers should address to ensure reliable data:

  • Standardized Sample Preparation:

    • Use consistent fixation methods (e.g., chemical fixation with glutaraldehyde followed by osmium tetroxide)

    • Process all samples in parallel to minimize batch-to-batch variation

    • Ensure uniform section thickness (typically 50-70 nm) for conventional EM or cryosections for immunogold labeling

  • Objective Counting Methodology:

    • Define clear criteria for CJ identification (e.g., tubular connections between inner boundary membrane and cristae membrane with specific diameter range)

    • Use blind counting where the analyst is unaware of sample identity

    • Count multiple sections from different cells (>50 mitochondrial sections per condition)

    • Report data as number of CJs per mitochondrial section or per unit of mitochondrial volume

  • Controls and Validations:

    • Include established reference strains (wild-type, Δfcj1) in each experiment

    • Verify phenotypes with complementary approaches (e.g., combine EM with fluorescence microscopy of mitochondrial networks)

    • Confirm protein expression levels by Western blotting, particularly for overexpression or domain deletion studies

  • Statistical Analysis:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple biological replicates (minimum three independent experiments)

    • Consider the inherent variability in mitochondrial morphology when interpreting results

    • Present data with appropriate error bars and significance indicators

  • Common Pitfalls and Solutions:

    • Variability due to growth conditions: Standardize media composition, growth phase, and temperature

    • Changes in mitochondrial volume: Normalize CJ counts to mitochondrial volume or membrane surface area

    • Misidentification of membrane structures: Use tomography rather than single sections for conclusive identification of CJs

    • Inconsistent immunogold labeling: Verify antibody specificity with knockout controls and optimize antibody concentration

By implementing these standardized approaches, researchers can generate more reliable and reproducible data on CJ formation in FCJ1 studies, facilitating comparison across different laboratories and experimental conditions.

What controls should be included when studying FCJ1 domain functions?

  • Expression Level Controls:

    • Verify that all FCJ1 variants are expressed at comparable levels using Western blotting

    • Use epitope-tagged versions (e.g., His-tagged FCJ1) for consistent detection

    • Check for potential degradation products that might confound interpretation

  • Localization Controls:

    • Confirm proper mitochondrial targeting of all variants using subcellular fractionation

    • Verify membrane insertion of transmembrane domain variants

    • For immunolocalization studies, include Δfcj1 strains as negative controls

  • Functional Complementation Tests:

    • Assess the ability of each variant to rescue growth defects of Δfcj1 strains, particularly on non-fermentable carbon sources (e.g., SLac)

    • Quantify rescue effect using both spot dilution assays and growth curves in liquid media

    • Measure the percentage of respiratory-deficient cells as an additional functional parameter

  • Morphological Verification:

    • Examine mitochondrial network morphology by fluorescence microscopy

    • Analyze cristae architecture by electron microscopy

    • Quantify specific features (CJs, cristae branching) to assess the degree of rescue

  • Crucial Genetic Controls:

    • Empty vector controls in complementation studies

    • Wild-type FCJ1 expressed from the same vector/promoter as experimental variants

    • Double mutants (e.g., Δfcj1/Δsue) to verify genetic interactions

    • Domain swaps rather than simple deletions to distinguish between sequence-specific and structural effects

  • Critical Experiment: Dominant-Negative Effects:

    • Express FCJ1 variants in wild-type background (not just in Δfcj1)

    • Look for interference with endogenous FCJ1 function, which can reveal mechanistically important interactions

    • Particularly important for variants lacking the C-terminal domain (dominant-negative effect on growth on non-fermentable carbon sources indicates functional significance)

A comprehensive experimental design should include this matrix of controls:

Control TypePurposeExamples
ExpressionVerify comparable protein levelsWestern blots with anti-FCJ1 or anti-tag antibodies
LocalizationConfirm proper targetingMitochondrial fractionation, immunofluorescence
FunctionalAssess biological activityGrowth assays on fermentable/non-fermentable media
MorphologicalEvaluate structural effectsEM analysis of cristae, CJ quantification
GeneticTest specific interactionsEpistasis analysis with F1FO subunit deletions
Dominant-negativeReveal mechanistic insightsExpression in wild-type background

By systematically implementing these controls, researchers can confidently attribute specific functions to individual FCJ1 domains and minimize misinterpretation due to experimental artifacts.

What are the potential applications of understanding FCJ1-mediated cristae organization in studying fungal pathogenesis?

Understanding FCJ1-mediated cristae organization could provide novel insights into fungal pathogenesis, particularly for Neosartorya fischeri infections:

  • Mitochondrial Function in Pathogenicity:

    • Investigate whether mitochondrial cristae organization affects virulence traits in N. fischeri

    • Examine if FCJ1 function impacts stress resistance, which could influence survival in host environments

    • Determine whether cristae remodeling plays a role in the fungal response to antifungal treatments

  • Comparative Studies:

    • Compare FCJ1 structure and function between pathogenic (N. fischeri) and non-pathogenic fungi

    • Investigate whether differences in cristae organization correlate with pathogenicity

    • Examine whether FCJ1 variants exist in clinical isolates with different levels of virulence or antifungal resistance

  • Host-Pathogen Interactions:

    • Study how host immune responses affect mitochondrial structure in N. fischeri

    • Investigate whether mitochondrial morphology changes during different stages of infection

    • Examine if FCJ1-dependent pathways are targeted by host defense mechanisms

  • Diagnostic Applications:

    • Develop improved detection methods for N. fischeri based on FCJ1 or other mitochondrial markers

    • Address the challenge of slow growth in culture by targeting mitochondrial proteins for rapid identification

    • Design molecular diagnostics that can distinguish N. fischeri from related Aspergillus species

  • Therapeutic Targets:

    • Evaluate whether FCJ1 or its interaction partners represent potential antifungal targets

    • Investigate if disruption of mitochondrial cristae organization could sensitize N. fischeri to existing antifungals

    • Explore whether differences between fungal and human mitochondrial architecture could be exploited for selective targeting

These research directions could significantly advance our understanding of the role of mitochondrial architecture in fungal pathogenesis and potentially lead to improved diagnostic and therapeutic approaches for invasive N. fischeri infections.

How might advanced imaging technologies enhance our understanding of FCJ1 dynamics?

Emerging imaging technologies offer unprecedented opportunities to study FCJ1 dynamics and functions:

  • Super-Resolution Microscopy Approaches:

    • STED (Stimulated Emission Depletion) microscopy: Achieve resolution below 50 nm to visualize individual CJs in intact mitochondria

    • PALM/STORM (Photoactivated Localization Microscopy/Stochastic Optical Reconstruction Microscopy): Map FCJ1 distribution with nanometer precision

    • SIM (Structured Illumination Microscopy): Observe dynamic changes in CJ distribution during mitochondrial remodeling

  • Live-Cell Imaging of FCJ1 Dynamics:

    • Develop fluorescent protein fusions that retain FCJ1 functionality

    • Use photoactivatable or photoconvertible tags to track FCJ1 movement within mitochondria

    • Implement FRAP (Fluorescence Recovery After Photobleaching) to measure FCJ1 mobility and turnover rates

    • Apply optogenetic approaches to manipulate FCJ1 function with spatial and temporal precision

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence microscopy of tagged FCJ1 with subsequent EM analysis

    • Identify specific FCJ1 clusters in living cells and examine their ultrastructure

    • Track dynamic events and capture them for high-resolution structural analysis

  • Cryo-Electron Tomography:

    • Visualize native FCJ1 complexes in situ at near-atomic resolution

    • Examine the structural basis of FCJ1 interactions with the TOB/SAM complex

    • Analyze the three-dimensional architecture of CJs without fixation artifacts

    • Implement subtomogram averaging to resolve the structure of FCJ1-containing complexes

  • Expansion Microscopy:

    • Physically expand mitochondrial samples to achieve super-resolution with conventional microscopes

    • Combine with immunolabeling to map the precise distribution of FCJ1 relative to other mitochondrial proteins

    • Enable multicolor imaging of protein complexes involved in CJ formation

These advanced imaging approaches would provide unprecedented insights into:

  • The dynamic assembly and disassembly of FCJ1 complexes

  • The spatial relationship between FCJ1 and F1FO ATP synthase during cristae remodeling

  • The temporal sequence of events in CJ formation

  • The molecular architecture of the FCJ1-TOB/SAM interface

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.