Recombinant Neosartorya fischeri High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Osmosensing

Sho1 activates the HOG pathway by detecting extracellular osmotic changes, leading to glycerol synthesis for cellular adaptation. In N. fischeri, Sho1:

  • Forms homooligomers at the plasma membrane .

  • Interacts with MAPKKK Ste11 to propagate signaling .

  • Lacks direct antifungal activity but modulates stress-response pathways critical for fungal survival .

Applications in Fungal Signaling Research

Recombinant Sho1 is used to study:

  • MAPK Pathway Dynamics: Structural analogs enable cross-species analysis of osmotic stress responses .

  • Protein-Protein Interactions: His-tagged variants facilitate pull-down assays to identify binding partners .

  • Antifungal Drug Development: Insights into Sho1’s role in fungal adaptation inform strategies to disrupt pathogen resilience .

Research Gaps and Future Directions

  • Species-Specific Variants: Recombinant N. fischeri Sho1 remains underexplored; current models rely on orthologs .

  • Structural Dynamics: NMR or cryo-EM studies are needed to resolve conformational changes during osmosensing .

  • Therapeutic Targeting: Sho1’s regulatory role in fungal stress responses could inspire novel antifungal adjuvants .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for a maximum of one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag if possible.
Synonyms
sho1; NFIA_078870; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
sho1
Target Protein Sequence
MAKFRASNILGDPFALATVSISILAWLIACIASIISDIKTDYPNYSWWAVAYMFCCIIGV TIVFGSDTGLVYGVAVVGYLSTGLVLTTLAVNTLVYADESSSQAAAAGFILLSMVIVVWI FYFGSSPQATHRGFIDSFALNKESSGAYGNRPMSTAFGPRPDTMSTSAPQMYTSAQLNGF ETSSPVSGYPGGAPGSENRSSSQARFGNPSASNVTGNNNGQDEVPQPTEYPYKAKAIYSY DANPEDANEISFSKHEILEVSDVSGRWWQARKSNGETGIAPSNYLILL
Uniprot No.

Target Background

Function
This protein acts as a plasma membrane osmosensor. It activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fischeri High osmolarity signaling protein sho1 and what is its molecular function?

Neosartorya fischeri High osmolarity signaling protein sho1 (sho1) is a membrane-bound osmosensor protein encoded by the sho1 gene (NFIA_078870). The protein functions as an osmosensor, detecting changes in environmental osmolarity and transmitting signals that allow the organism to adapt to osmotic stress conditions. The full-length protein consists of 288 amino acids and contains transmembrane domains characteristic of membrane-bound sensory proteins . Like its homologs in related species such as Neosartorya fumigata, the sho1 protein plays a crucial role in stress adaptation pathways, allowing these filamentous fungi to respond to changing environmental conditions .

Methodologically, researchers investigating sho1 function typically employ gene knockout studies, protein localization experiments, and signaling pathway analyses to elucidate the precise mechanisms by which this protein senses and responds to osmotic stress. When examining functional conservation, comparative analyses with homologs from other Aspergillus and Neosartorya species can provide valuable insights into evolutionary adaptations.

How does Neosartorya fischeri sho1 compare with homologous proteins in related fungal species?

When comparing the sho1 protein from Neosartorya fischeri with its homolog in Neosartorya fumigata, several noteworthy similarities and differences emerge:

Methodologically, comparative genomic and proteomic approaches can reveal how selective pressures have shaped the evolution of osmosensing mechanisms across fungal lineages.

What expression systems are most suitable for producing functional recombinant Neosartorya fischeri sho1 protein?

Based on current research approaches, several expression systems can be employed for producing recombinant Neosartorya fischeri sho1 protein, each with distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli- High yield
- Well-established protocols
- Cost-effective
- Potential improper folding
- Lacks eukaryotic PTMs
- Initial structural studies
- Antibody production
Yeast (S. cerevisiae, P. pastoris)- Eukaryotic processing
- Better protein folding
- Some PTMs
- Lower yield than E. coli
- More complex protocols
- Functional studies
- Protein-protein interaction analyses
Aspergillus expression systems- Native-like processing
- Authentic PTMs
- Natural folding environment
- Lower yield
- More challenging protocols
- High-fidelity functional studies
- Signaling pathway investigations

Methodologically, researchers should validate protein functionality regardless of the chosen expression system, using activity assays specific to osmosensing functions or structural integrity assessments.

What are the optimal conditions for storage and handling of recombinant sho1 protein?

To maintain the structural integrity and functional activity of recombinant Neosartorya fischeri sho1 protein, researchers should adhere to the following storage and handling recommendations:

  • Short-term storage (1-2 weeks): Store working aliquots at 4°C in an appropriate buffer system to minimize freeze-thaw cycles .

  • Long-term storage: Store at -20°C or preferably at -80°C for extended preservation .

  • Buffer composition: A Tris-based buffer with 50% glycerol has been demonstrated to be effective for stabilizing the protein structure . Alternatively, Tris/PBS-based buffer with 6% trehalose at pH 8.0 has also shown good results with the homologous protein .

  • Aliquoting: Divide the purified protein into single-use aliquots before freezing to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity .

  • Reconstitution of lyophilized protein: When working with lyophilized preparations, briefly centrifuge the vial before opening to ensure all material is at the bottom. Reconstitute in deionized sterile water or an appropriate buffer .

Implementing these storage protocols will help maintain protein stability and biological activity for experimental applications. Researchers should validate protein integrity after extended storage periods using techniques such as SDS-PAGE, circular dichroism, or functional assays.

How can researchers assess the functional activity of recombinant sho1 protein in vitro?

Assessing the functional activity of recombinant Neosartorya fischeri sho1 protein requires multifaceted approaches that address its role as an osmosensor. The following methodological strategies are recommended:

  • Membrane binding assays: Since sho1 is a membrane-associated protein, liposome binding assays can assess whether the recombinant protein maintains proper membrane interaction capabilities. Fluorescently labeled protein can be used to quantify membrane association under various osmotic conditions.

  • Conformational change analysis: Techniques such as tryptophan fluorescence spectroscopy can detect conformational changes in the protein structure in response to osmotic stress, indicating functional sensing capability.

  • Protein-protein interaction studies: Pull-down assays, co-immunoprecipitation, or yeast two-hybrid analyses can identify whether recombinant sho1 interacts with known downstream signaling partners in response to osmotic changes.

  • Heterologous expression functional complementation: Testing whether recombinant sho1 can complement osmosensing defects in yeast sho1 mutants provides a powerful functional validation approach .

  • Electrophysiological measurements: For advanced studies, reconstituting sho1 into artificial membranes and measuring electrical properties under varying osmotic conditions can provide direct evidence of sensing activity.

When interpreting functional activity data, researchers should consider that the presence of mono- and divalent cations (such as KCl, Mg²⁺, Na⁺) may impact protein activity, as has been observed with other fungal proteins from Neosartorya fischeri .

What experimental approaches can be used to study sho1 protein localization and trafficking?

Understanding sho1 protein localization and trafficking is crucial for elucidating its function in osmotic stress response. Several complementary experimental approaches are recommended:

  • Fluorescent protein tagging: Generating GFP or other fluorescent protein fusions with sho1 allows for live-cell imaging of protein localization and dynamic trafficking in response to osmotic stress.

  • Immunofluorescence microscopy: Using specific antibodies against sho1 or epitope tags for fixed-cell imaging can provide high-resolution localization data without potentially disrupting function through large fusion proteins.

  • Subcellular fractionation: Biochemical separation of membrane fractions followed by Western blotting can quantitatively assess the distribution of sho1 between different membrane compartments.

  • Transmission electron microscopy with immunogold labeling: This technique provides ultrastructural resolution of protein localization that can resolve precise membrane subdomain distribution.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can assess the mobility and turnover of sho1 in membranes under different osmotic conditions.

When designing these experiments, researchers should be mindful that membrane protein localization studies can be affected by overexpression artifacts. Therefore, expressing sho1 at physiological levels is preferable when studying localization patterns. Additionally, combining multiple complementary approaches provides more robust localization data than relying on a single technique.

How does the sho1 protein contribute to osmotic stress responses in filamentous fungi?

The sho1 protein plays a critical role in osmotic stress adaptation in filamentous fungi through several interconnected mechanisms:

  • Osmotic sensing: As a membrane-bound sensor, sho1 detects changes in environmental osmolarity, likely through conformational changes induced by membrane tension alterations .

  • Signal transduction activation: Upon sensing osmotic stress, sho1 activates downstream MAPK (Mitogen-Activated Protein Kinase) cascades, particularly the HOG (High Osmolarity Glycerol) pathway, which is crucial for osmoadaptation.

  • Transcriptional reprogramming: The activated signaling pathways lead to transcriptional changes that upregulate genes involved in compatible solute production (glycerol, trehalose) to counterbalance osmotic pressure differences.

  • Cell wall remodeling coordination: Sho1 signaling contributes to cell wall modifications necessary for maintaining cellular integrity during osmotic fluctuations, which is particularly important in filamentous fungi with their complex growth patterns.

Experimental evidence from studies with related proteins in Aspergillus species indicates that disruption of osmoregulatory pathways leads to hyphal growth abnormalities, including delayed germination, abnormal branching, and structural defects in the cell wall . These manifestations highlight the importance of proper osmotic sensing for fungal development and survival.

For researchers investigating these mechanisms, genetic approaches (gene knockouts, point mutations) combined with phenotypic characterization and downstream signaling component phosphorylation analysis provide the most comprehensive insights into sho1 function in osmotic stress responses.

What is the relationship between sho1 protein function and antifungal susceptibility?

The relationship between sho1 protein function and antifungal susceptibility represents an emerging area of research with significant implications for developing novel antifungal strategies:

  • Cell wall integrity: Since sho1 signaling contributes to cell wall maintenance, disruption of its function may increase susceptibility to cell wall-targeting antifungals like echinocandins. Conversely, some fungi may develop compensatory mechanisms that actually increase resistance when sho1 function is compromised.

  • Stress adaptation pathways: The osmotic stress response overlaps with pathways that respond to antifungal stressors. Research with Neosartorya fischeri has demonstrated that fungal proteins involved in stress responses can affect susceptibility to various environmental challenges .

  • Potential as a drug target: The sho1 protein itself may represent a novel target for antifungal development, particularly given its role in adaptation to host environments where osmotic conditions fluctuate.

  • Cross-talk with virulence mechanisms: In pathogenic Neosartorya species, osmosensing through sho1 may coordinate with virulence mechanisms, as suggested by the critical role of related signaling pathways in fungal pathogenesis .

Studies with antifungal proteins from Neosartorya fischeri have demonstrated that disruption of normal cell function can lead to accumulation of reactive oxygen species (ROS), abnormal germination, and ultimately cell death pathways . While these studies did not directly involve sho1, they illustrate how perturbation of fungal stress response systems can create vulnerability to antifungal agents.

For researchers exploring this connection, combining minimum inhibitory concentration (MIC) testing of various antifungals against wild-type and sho1-mutant strains, along with transcriptomic analysis of stress responses, would provide valuable insights into potential therapeutic applications.

How can heterologous expression systems be optimized to study sho1 protein interactions with downstream signaling partners?

Optimizing heterologous expression systems to study sho1 protein interactions requires careful consideration of multiple factors:

ParameterOptimization StrategyMethodological Considerations
Expression vectorSelect vectors with inducible promoters (e.g., GAL1 for yeast, IPTG-inducible for E. coli)Allows titration of expression levels to avoid artifacts from overexpression
Fusion tagsUse small epitope tags (FLAG, HA) for interaction studies rather than bulky tags that may interfere with bindingPosition tags at termini less likely to interfere with interaction interfaces
Host systemSelect hosts with minimal endogenous interaction partners (e.g., yeast sho1 mutants for complementation studies)Reduces background and false positives in interaction assays
Membrane environmentConsider expression in systems that provide appropriate membrane compositionMembrane proteins often require specific lipid environments for proper folding and function
Co-expressionDesign systems for simultaneous expression of sho1 and putative interaction partnersEnables formation of complexes during synthesis, which may be critical for certain interactions

When conducting protein-protein interaction studies, researchers should implement multiple complementary techniques, such as:

  • Co-immunoprecipitation: Effective for detecting stable interactions but may miss transient associations.

  • Bimolecular Fluorescence Complementation (BiFC): Allows visualization of interactions in living cells.

  • Proximity Labeling (BioID, APEX): Identifies proteins in the vicinity of sho1, including transient interactors.

  • Surface Plasmon Resonance (SPR): Provides quantitative binding parameters for purified components.

Heterologous expression studies with fungal proteins from Neosartorya fischeri have previously revealed important insights into protein function, as demonstrated in studies with NFAP where expression in A. nidulans allowed detailed characterization of its antimicrobial effects . Similar approaches with sho1 would likely yield valuable data on its interaction network.

What are common challenges in purifying active recombinant sho1 protein and how can they be addressed?

Purifying active recombinant sho1 protein presents several challenges due to its membrane-associated nature. Researchers frequently encounter these issues and can employ the following solutions:

  • Low solubility and aggregation:

    • Challenge: As a membrane protein, sho1 contains hydrophobic domains that can cause aggregation during expression and purification.

    • Solution: Use mild detergents (DDM, CHAPS) or lipid nanodiscs to maintain native-like membrane environments. Optimize detergent concentration through small-scale trials before scaling up .

  • Improper folding:

    • Challenge: Heterologous expression systems may not provide the correct folding environment.

    • Solution: Express at lower temperatures (16-20°C) to slow folding and consider specialized E. coli strains with enhanced disulfide bond formation capabilities. Addition of chemical chaperones like glycerol or trehalose to buffer systems can also improve folding .

  • Low yield:

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the host system and consider using stronger promoters or higher cell density cultivation methods. For E. coli expression, auto-induction media can often improve yields of challenging proteins .

  • Protein instability during purification:

    • Challenge: The multi-domain structure of sho1 may be prone to degradation.

    • Solution: Include protease inhibitors throughout purification, minimize purification time, and maintain consistently cold temperatures. Consider using buffer systems with stabilizing agents like glycerol or specific ions .

  • Loss of activity:

    • Challenge: Purification steps may disrupt functional conformation.

    • Solution: Validate activity after each purification step to identify problematic conditions. Consider mild purification approaches that maintain native-like environments, such as affinity purification under non-denaturing conditions .

Methodologically, researchers should develop activity assays that can be performed at multiple stages of purification to track retention of functional properties throughout the process.

How can researchers distinguish between specific and non-specific effects when studying sho1 protein function?

Distinguishing specific from non-specific effects is critical when studying sho1 protein function. Researchers should implement these methodological controls and analytical approaches:

  • Mutational analysis:

    • Generate point mutations in key functional domains of sho1 (e.g., in predicted binding sites or transmembrane regions)

    • Compare effects of these specific mutations with global disruption to separate domain-specific functions from general structural requirements

  • Dose-response relationships:

    • Establish clear dose-response curves for sho1-dependent effects

    • True specific effects typically show saturable response patterns, while non-specific effects often display linear relationships with concentration

  • Competition assays:

    • Use unlabeled sho1 protein to compete with labeled or active protein

    • Specific interactions should be competitively inhibited, while non-specific effects often cannot be competed away

  • Control proteins:

    • Use structurally similar but functionally distinct proteins as negative controls

    • Closely related proteins with known different functions can help distinguish specific pathway activation

  • Rescue experiments:

    • In knockout or knockdown studies, rescue with wild-type sho1 should restore function

    • Failed rescue with mutant versions supports specificity of the observed effects

Studies with antifungal proteins from Neosartorya fischeri have demonstrated that specific effects can be distinguished by their sensitivity to environmental conditions - for example, the inhibitory effects of NFAP were negated by mono- and divalent cations (50 and 100 mM KCl, Mg²⁺SO₄, Na₂SO₄), suggesting specific rather than general toxic effects . Similar approaches could be applied to sho1 functional studies.

When analyzing experimental data, researchers should be particularly attentive to potential off-target effects when working with overexpression systems, as artificially high concentrations of membrane proteins can disrupt membrane integrity independent of their specific signaling functions.

What emerging technologies could advance our understanding of sho1 protein structure-function relationships?

Several cutting-edge technologies show particular promise for elucidating sho1 protein structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables structural determination of membrane proteins in near-native environments

    • Recent advances in single-particle analysis allow resolution of smaller proteins like sho1

    • Could reveal conformational changes associated with osmosensing activity

  • AlphaFold and other AI-based structure prediction:

    • Deep learning approaches now predict protein structures with unprecedented accuracy

    • Particularly valuable for membrane proteins that are challenging to crystallize

    • Can generate testable hypotheses about structure-function relationships

  • Single-molecule fluorescence resonance energy transfer (smFRET):

    • Allows direct observation of dynamic conformational changes in individual protein molecules

    • Could capture osmosensing-associated structural shifts in real-time

    • Particularly powerful when combined with controlled osmotic manipulation

  • Nanobody-based approaches:

    • Development of conformation-specific nanobodies as crystallization chaperones

    • Can stabilize specific functional states for structural studies

    • May also serve as tools to probe functional states in living cells

  • Proximity labeling proteomics (BioID, APEX):

    • Enables comprehensive mapping of protein interaction networks in native cellular contexts

    • Can capture transient interactions that may be missed by traditional approaches

    • Particularly valuable for understanding signaling hub functions

The field of fungal protein research has already demonstrated the value of integrating multiple methodological approaches, as seen in studies of Neosartorya fischeri antifungal proteins where combining heterologous expression with microscopy and biochemical analysis revealed complex mechanisms of action . Similar multi-technique approaches would likely yield valuable insights into sho1 protein function.

How might research on sho1 protein contribute to developing novel antifungal strategies?

Research on the Neosartorya fischeri sho1 protein holds significant potential for developing innovative antifungal strategies through several promising avenues:

  • Target-based drug design:

    • As an essential component of stress adaptation, sho1 represents a potential drug target

    • Structural studies could facilitate rational design of molecules that disrupt sho1 function

    • Inhibitors could potentially reduce fungal survival under the variable osmotic conditions encountered during infection

  • Pathway-based combination therapies:

    • Understanding sho1 signaling networks could reveal synergistic targets

    • Combining inhibitors of osmotic stress response with conventional antifungals may increase efficacy

    • May help address the growing challenge of antifungal resistance

  • Biomarker development:

    • Sho1 activation or downstream signaling events could serve as biomarkers for antifungal efficacy

    • Could enable rapid screening of compound libraries for novel antifungal candidates

    • May also provide insights into mechanisms of resistance development

  • Immunomodulatory approaches:

    • Knowledge of how sho1-mediated adaptations affect host-pathogen interactions

    • Could inform development of immunotherapies that target fungal stress adaptation

    • Particularly relevant for immunocompromised patients at high risk for invasive fungal infections

Recent research has demonstrated that fungal-specific proteins can serve as effective antifungal targets, as seen with the Neosartorya fischeri antifungal protein (NFAP), which affects cell wall organization, induces reactive oxygen species accumulation, and triggers apoptotic/necrotic events . These findings suggest that targeting stress response proteins like sho1 could disrupt multiple aspects of fungal physiology simultaneously.

The growing awareness of rare but serious fungal infections, such as those caused by Neosartorya species in immunocompromised patients, underscores the importance of developing novel antifungal strategies with different mechanisms of action from conventional drugs . Research on fundamentally important proteins like sho1 could contribute significantly to addressing this clinical need.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.