Recombinant Neosartorya fischeri Mitochondrial outer membrane protein iml2 (iml2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
iml2; NFIA_015310; Inclusion body clearance protein iml2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
iml2
Target Protein Sequence
MFRVGSWLYGKKPAANASTQSLDSLVELRDPATLILNDDVDGAEAGLAEGTSTFHNLGRG VVAFIRATLGFEQDIMRQASERLNEAETSASVDQHRAQHNSHAPNTYHSPMYSPGTEFAL CQAIAQLMSAIVGVLNESLTESIKAFYRLRKAYITLDAILKMEQKYMEESRSATLVESTT SGSVPSSQRHSSSNLQSSSSSISSAKVKEATADTLAAPSKDTDVNERLADLSLSGEAPVA EDPGQTPTPINTDILDHDPDSDIFQNQIDVFVHSGSNFCFGVLLLLISMVPPSFSKLLSI IGFHGDKERGLKMLWQASKFHNLIGGIAAFAILGYYNGFVRYCDIMPDSIPGKDGDVQGY PQKRLELLLAKMRERFPKSQLWLLEESRMSGANKNLDRALELLCGEERSPLKQVEALRVF ERSLNAMYLHKYELCADSFLECVDLNSWSRSLYYYIAGSCHLSLYRDVKETDSAKAAKHA ELAEKYFRMAPTVAGKKRFMARQLPFDVFVARKFAKWEARAKEWKVSLVDAVGIDPIEEM IFFWNGHSRMTDEQLQESLQKLAWSESNANTTWSREGPEEKAILKLLRAAVHRSLRKHTQ AKEMLEDILGQDRTLFKGHLKDDWICPVAHFEMAANLWMERPTYIANHSGAKQDSDKESA GPADAKDALQYERERVRKCKEYLEKAAKWESYELDARIGLKVTAAMEAVQKWESTHPTV
Uniprot No.

Target Background

Function
A resident protein of inclusion bodies (IBs) that exhibits strong interaction with lipid droplet (LD) proteins. It participates in LD-mediated clearance of IBs following protein folding stress, likely by facilitating access to the IBs of a chaperone-acting, LD-stored soluble sterol derivative involved in inclusion body clearance.
Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is Neosartorya fischeri Mitochondrial outer membrane protein iml2?

Mitochondrial outer membrane protein iml2 (iml2) is a membrane-spanning protein encoded by the imL2 gene (ORF name: NFIA_015310) in the filamentous fungus Neosartorya fischeri. The protein consists of 719 amino acids and is localized to the mitochondrial outer membrane where it likely participates in protein insertion pathways . The UniProt accession number for this protein is A1D345, identifying it as a component of the mitochondrial membrane proteome. Based on comparative analysis with other mitochondrial membrane proteins, iml2 likely functions in the assembly and insertion of specific mitochondrial outer membrane proteins, similar to the MIM (mitochondrial import machinery) complex in Saccharomyces cerevisiae .

How is recombinant iml2 typically stored and handled in laboratory settings?

Recombinant Neosartorya fischeri iml2 is typically supplied at a concentration of 50 μg and should be stored in a Tris-based buffer containing 50% glycerol . For optimal stability, the protein should be stored at -20°C, with extended storage recommended at either -20°C or -80°C . When working with the protein, researchers should avoid repeated freeze-thaw cycles, as this can compromise protein integrity and activity. Instead, creating working aliquots stored at 4°C is recommended for experiments lasting up to one week . The type of tag used for purification and detection is typically determined during the production process and should be verified for each batch to ensure compatibility with downstream applications and antibodies .

What are the common experimental applications for recombinant iml2?

Recombinant iml2 can be utilized in multiple experimental contexts including:

  • Protein-protein interaction studies: To identify binding partners within the mitochondrial protein import network using techniques such as co-immunoprecipitation, pull-down assays, or crosslinking approaches.

  • In vitro reconstitution experiments: Similar to studies with the MIM complex, iml2 can be reconstituted into liposomes to assess its capacity to form pores or facilitate protein insertion .

  • Structural analysis: Purified recombinant iml2 can be used for structural studies including X-ray crystallography or cryo-electron microscopy to determine its three-dimensional conformation.

  • ELISA-based detection: As indicated by the product description, the recombinant protein is suitable for ELISA applications, enabling quantitative detection of iml2 or monitoring of antibody responses against it .

  • Complementation studies: Following the approach used with Mim1/Mim2 and pATOM36, recombinant iml2 could be tested for its ability to functionally complement deletion mutants of related proteins in other fungal species .

What role does iml2 play in mitochondrial membrane protein biogenesis?

While specific studies on iml2's role are not extensively documented in the provided search results, insights can be gleaned from functionally similar proteins. Based on knowledge of the MIM complex in yeast, iml2 likely functions in at least one of three potential capacities:

  • Direct insertase activity: Iml2 may function as a standalone insertase for single-spanning and tail-anchored α-helical proteins in the mitochondrial outer membrane. This function would be analogous to one of the three distinct conformations of the MIM complex identified in yeast .

  • TOM complex assembly factor: Similar to Mim1 (Tom13) in yeast, iml2 may assist in the assembly of components of the TOM complex, particularly the single-pass transmembrane proteins like Tom5, Tom6, Tom20, and Tom70 .

  • Multi-spanning protein assembly: Iml2 might facilitate the insertion of multi-spanning membrane proteins involved in mitochondrial dynamics, similar to the role of MIM in assembling Ugo1 and Fzo1 in yeast mitochondria .

Experimental approaches like complementation assays, where iml2 is expressed in yeast strains lacking Mim1/Mim2, could help elucidate which of these functions iml2 can perform.

How does iml2 compare functionally to the Mim1/Mim2 complex in yeast or pATOM36 in trypanosomes?

The functional comparison between iml2 and better-characterized systems like Mim1/Mim2 or pATOM36 reveals several interesting parallels and potential differences:

FeatureMim1/Mim2 (Yeast)pATOM36 (Trypanosomes)iml2 (N. fischeri)
Molecular compositionHeterodimeric complexSingle proteinSingle protein
Membrane topologySpans outer membraneSpans outer membraneLikely spans outer membrane
Substrate specificitySingle and multi-spanning α-helical proteinsMOM proteins including ATOM complex componentsPredicted to handle α-helical MOM proteins
Evolutionary originFungi-specificTrypanosomatid-specificFilamentous fungi
Functional complementationCan replace pATOM36 in trypanosomesCan replace Mim1/Mim2 in yeastPotential for complementation not yet tested

Remarkably, research has shown that despite no sequence or topological similarity, pATOM36 can functionally replace Mim1/Mim2 in yeast, rescuing growth defects, mitochondrial morphology, and MOM protein biogenesis . This functional interchangeability between evolutionarily distinct proteins suggests a case of convergent evolution in mitochondrial protein assembly systems. Similar experiments with iml2 could reveal whether it shares this functional flexibility with either system.

What experimental approaches are optimal for studying iml2 function in vitro?

To effectively study iml2 function in vitro, researchers can employ several complementary approaches:

  • Liposome reconstitution assays: Purified recombinant iml2 can be incorporated into liposomes to assess its capacity to form pores or facilitate protein insertion, similar to studies done with Mim1 . This approach allows researchers to measure the protein's intrinsic activity in a controlled membrane environment.

  • Electrophysiological measurements: After reconstitution into planar lipid bilayers, patch-clamp techniques can determine whether iml2 forms pores and characterize their electrophysiological properties, including conductance, ion selectivity, and voltage dependence.

  • Protein insertion assays: In vitro translated substrate proteins can be incubated with liposomes containing recombinant iml2 to assess its capacity to facilitate membrane insertion. Successful insertion can be monitored through protease protection assays or by density gradient centrifugation .

  • Structural analyses: Techniques such as circular dichroism spectroscopy, NMR, or X-ray crystallography can provide insights into iml2's secondary and tertiary structure, helping identify domains essential for substrate recognition and insertion.

  • Crosslinking studies: Chemical crosslinking combined with mass spectrometry can map interaction surfaces between iml2 and potential substrate proteins, providing molecular details of the insertion mechanism.

How can researchers effectively use recombinant iml2 in mitochondrial import assays?

To effectively utilize recombinant iml2 in mitochondrial import assays, researchers should consider the following methodological approach:

  • Preparation of radiolabeled substrates: In vitro translate potential substrate proteins in the presence of [35S]-methionine to generate radiolabeled precursors for tracking during import.

  • Isolation of mitochondria: Isolated mitochondria can be obtained from wild-type organisms or from strains with endogenous iml2 deleted or depleted. Mitochondrial isolation should follow established protocols such as differential centrifugation as described for yeast mitochondria .

  • Import reactions: Combine radiolabeled precursors with isolated mitochondria supplemented with recombinant iml2. The reaction should include an energy source (ATP) and be conducted at physiological temperature (25-30°C for fungal systems).

  • Monitoring import efficiency: After import, treat samples with proteinase K to digest non-imported proteins. Compare import efficiency between mitochondria with and without recombinant iml2 supplementation.

  • Analysis of membrane integration: Following import, perform alkaline extraction (with sodium carbonate, pH 11.5) to distinguish between membrane-integrated proteins (pellet fraction) and soluble or peripherally associated proteins (supernatant fraction) .

  • Blue native PAGE analysis: To assess whether imported proteins assemble into native complexes, solubilize mitochondria in mild detergents and analyze by blue native PAGE followed by autoradiography or immunoblotting .

What are the current challenges in studying iml2's molecular interactions with other proteins?

Several challenges complicate the study of iml2's molecular interactions:

  • Membrane protein solubility: As a membrane protein, iml2 presents inherent challenges for purification in a native, correctly folded state. The selection of appropriate detergents or nanodiscs is critical for maintaining protein structure and function during interaction studies.

  • Transient interactions: If iml2 functions similar to the MIM complex, it may engage in transient interactions with substrate proteins during the insertion process. These interactions can be difficult to capture using traditional methods like co-immunoprecipitation.

  • Complex formation: Determining whether iml2 functions as a monomer or forms higher-order oligomeric structures requires careful biochemical characterization using techniques like blue native PAGE, analytical ultracentrifugation, or size exclusion chromatography coupled with multi-angle light scattering.

  • Substrate identification: Identifying the complete repertoire of iml2 substrates presents a significant challenge. Approaches combining proteomics analysis of mitochondria from iml2-depleted cells with in vitro binding assays using recombinant iml2 could help address this challenge.

  • Functional redundancy: Potential functional overlap with other mitochondrial insertion pathways may complicate phenotypic analysis of iml2 deletion or depletion. Careful design of experiments that can distinguish direct from indirect effects is necessary.

What structural domains of iml2 are responsible for its function in protein insertion?

Based on the amino acid sequence provided for iml2 and knowledge of related proteins, several key structural domains likely contribute to its function:

  • Transmembrane domains: The hydrophobic segments within iml2's sequence likely form membrane-spanning helices that anchor the protein in the mitochondrial outer membrane . These transmembrane domains may create a protected environment for substrate proteins during membrane insertion.

  • Cytosolic domains: Regions exposed to the cytosol would be involved in initial recognition of incoming substrate proteins. These domains may contain binding sites for chaperones or other factors that deliver substrates to the mitochondrial surface.

  • Intermembrane space (IMS) domains: Portions of iml2 that extend into the IMS could facilitate completion of the insertion process or interact with components residing in this compartment.

To precisely identify functional domains, researchers could employ:

  • Truncation analysis to map regions essential for activity

  • Site-directed mutagenesis of conserved residues

  • Domain swapping with related proteins from other species

  • Crosslinking followed by mass spectrometry to identify regions that contact substrate proteins

How do mutations in iml2 affect mitochondrial function and morphology?

While specific data on iml2 mutations are not available in the provided search results, insights can be drawn from studies of related proteins. In yeast, deletion of Mim1 and/or Mim2 results in:

  • Growth defects: Particularly on non-fermentable carbon sources, indicating compromised mitochondrial respiration .

  • Altered mitochondrial morphology: Loss of MIM components leads to condensation of the normally tubular mitochondrial network .

  • Reduced steady-state levels of MIM substrates: Proteins like Tom20, Tom70, and Ugo1 show decreased abundance in mitochondria lacking MIM components .

  • Impaired assembly of the TOM complex: Resulting in defective protein import into various mitochondrial compartments .

Similarly, depletion of pATOM36 in trypanosomes causes condensation of the network-like mitochondrial structure . For iml2, targeted mutagenesis approaches could help determine:

  • Which residues are essential for function

  • Whether specific domains mediate different aspects of its activity (substrate recognition versus insertion)

  • How mutations affect interactions with other components of the mitochondrial protein import machinery

What are the recommended protocols for analyzing iml2 complex formation?

To effectively analyze iml2 complex formation, researchers should consider the following protocol framework:

  • Sample preparation:

    • Isolate mitochondria using differential centrifugation as described for yeast systems

    • Solubilize mitochondria in mild detergents (digitonin 1-2% or n-dodecyl-β-D-maltoside 0.5-1%)

    • Clarify the lysate by centrifugation (20,000 × g, 15 min, 4°C)

  • Blue Native PAGE analysis:

    • Load solubilized samples onto 4-16% gradient BN-PAGE gels

    • Include appropriate molecular weight markers

    • Run gels at 4°C, starting at 100V and increasing to 250V

    • For detection, perform western blotting using antibodies against iml2 or epitope tags

  • Two-dimensional analysis:

    • Cut lanes from the first-dimension BN-PAGE

    • Equilibrate in SDS-PAGE sample buffer containing DTT

    • Position horizontally atop a second-dimension SDS-PAGE gel

    • After separation, perform western blotting to identify components of the complex

  • Co-immunoprecipitation:

    • Prepare mitochondrial lysates as described above

    • Incubate with antibodies against iml2 or potential interaction partners

    • Capture complexes using protein A/G beads

    • Wash extensively and elute under native or denaturing conditions

    • Analyze by SDS-PAGE and western blotting

  • Size exclusion chromatography:

    • Apply solubilized mitochondrial extracts to a Superose 6 or similar column

    • Collect fractions and analyze by western blotting to determine co-elution patterns

    • Compare elution profiles with known molecular weight standards

How can researchers distinguish between direct and indirect effects of iml2 in mitochondrial outer membrane protein assembly?

Distinguishing direct from indirect effects of iml2 requires a multi-faceted experimental approach:

  • In vitro reconstitution: The most definitive approach involves reconstituting purified recombinant iml2 into liposomes and testing its ability to directly facilitate insertion of purified substrate proteins. This system eliminates confounding factors present in cellular contexts.

  • Time-course analysis: Following acute depletion of iml2 (e.g., using inducible knockout systems), monitor the kinetics of different phenotypes. Direct effects typically manifest more rapidly than indirect consequences.

  • Substrate-specific analysis: Compare the import defects for different classes of proteins following iml2 depletion. Direct substrates will show immediate import defects, while proteins dependent on other pathways may be affected only as a secondary consequence.

  • Crosslinking approaches: Use site-specific or non-specific crosslinkers to capture transient interactions between iml2 and potential substrate proteins during the insertion process. These interactions indicate direct functional relationships.

  • Genetic suppression analysis: Identify suppressors that can bypass the requirement for iml2 for specific substrates but not others, helping delineate direct from indirect functional relationships.

  • Complementation with functional domains: Express specific domains of iml2 and assess which functional defects they can complement, providing insights into the direct activities of different protein regions.

What are the evolutionary implications of iml2's role in eukaryotic cells?

The evolutionary aspects of iml2 provide fascinating insights into the diversification of mitochondrial protein import systems:

  • Convergent evolution: Studies on the Mim1/Mim2 complex and pATOM36 have revealed an example of convergent evolution, where proteins with no sequence or topological similarity perform equivalent functions in distant eukaryotic lineages . Iml2 likely represents another point in this evolutionary landscape, potentially sharing functional but not structural homology with these systems.

  • Lineage-specific adaptations: The existence of distinct protein insertion machineries in different eukaryotic lineages (fungi, trypanosomatids) suggests adaptation to specific mitochondrial proteome requirements. Comparative analysis of iml2 with related proteins could reveal how these adaptations occurred.

  • Functional conservation despite structural divergence: The ability of pATOM36 to functionally replace Mim1/Mim2 in yeast demonstrates remarkable conservation of function despite complete structural divergence . Testing whether iml2 can similarly complement these systems would provide insights into the extent of this functional conservation.

  • Co-evolution with substrate proteins: The evolution of mitochondrial insertion systems likely occurred in parallel with changes in their substrate proteins. Analyzing the correlation between iml2 evolution and changes in MOM proteins could reveal co-evolutionary relationships.

  • Origin and diversification: Comparative genomic analyses across fungal lineages could reveal when iml2 first appeared and how it diversified, providing insights into the evolution of mitochondrial biogenesis pathways in this important group of organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.