Recombinant Neosartorya fischeri Mitochondrial thiamine pyrophosphate carrier 1 (tpc1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant tpc1 is a 317-amino acid protein (UniProt ID: A1DI57) expressed in E. coli with an N-terminal His-tag for purification . Key structural and biochemical properties include:

PropertyDetails
Molecular Weight~35 kDa (calculated)
Amino Acid SequenceMSAGGEHLKDEGTRRQVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPASHRDVVGPIYKGTLSTMRAIIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQVLAQLDPHRLPPALESFVSGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVQDIARNEGPAGFFRGCSAAVGQIVPYMGLFFATYESLRPVLSGLENMPFGSGDAAAGVIASVLAKTGVFPLDLVRKRLQVQGPTRTLYVHRNIPEYRGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITMWTYERSLKLLHDFRVAE
Purity≥90% (SDS-PAGE)
Storage Conditions-20°C/-80°C in Tris/PBS-based buffer with 6% trehalose (pH 8.0)

The protein belongs to the mitochondrial carrier family (MCF), characterized by six transmembrane domains critical for substrate translocation .

Biological Function

tpc1 facilitates the transport of ThPP—a coenzyme essential for acetyl-CoA synthesis and carbohydrate metabolism—across the mitochondrial inner membrane. Key functional insights include:

  • Substrate Specificity: Demonstrates high affinity for ThPP but also transports pyrophosphate and nucleotides (ADP/ATP) in exchange .

  • Mechanism: Operates via an electroneutral antiport system, exchanging ThPP for intramitochondrial ATP or ADP .

  • Genetic Complementation: Heterologous expression of tpc1 homologs in Saccharomyces cerevisiae TPC1-null mutants restores growth on fermentable carbon sources, confirming functional conservation .

Biochemical Reconstitution Studies

Reconstitution of purified tpc1 into liposomes enables kinetic analysis of ThPP transport. Key parameters derived from homologous systems include:

ParameterValueSource Organism
KmK_m (ThPP)12.6 ± 1.8 µMDrosophila melanogaster
VmaxV_{max}68 ± 5 nmol/min/mg proteinDrosophila melanogaster
pH Optimum7.0–7.5Saccharomyces cerevisiae

These data suggest conserved transport kinetics across fungal and metazoan homologs .

Industrial and Biomedical Relevance

While direct therapeutic applications of tpc1 remain unexplored, related Neosartorya fischeri proteins (e.g., NFAP antifungal peptides) exhibit biofungicidal activity against phytopathogens and Candida auris biofilms . tpc1’s role in mitochondrial metabolism positions it as a potential target for metabolic engineering or antifungal adjunct therapies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tpc1; NFIA_090220; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
tpc1
Target Protein Sequence
MSAGGEHLKDEGTRRQVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPASHRDVVG PIYKGTLSTMRAIIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQVLAQLDPHRLP PALESFVSGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVQDIARNEGPAGFFR GCSAAVGQIVPYMGLFFATYESLRPVLSGLENMPFGSGDAAAGVIASVLAKTGVFPLDLV RKRLQVQGPTRTLYVHRNIPEYRGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITM WTYERSLKLLHDFRVAE
Uniprot No.

Target Background

Function
This mitochondrial transporter facilitates the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.