Recombinant Neosartorya fischeri NADH-cytochrome b5 reductase 1 (cbr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cbr1; NFIA_089250; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
cbr1
Target Protein Sequence
MSALSSENINGVYIPSALLIFGTFIVKKEFVPYAVALTAILAGLKLFTGGSKPRKVLNPT EFQEFVLKEKTDISHNVCIYRFALPRPADILGLPIGQHISLAATIEGQPKEVVRSYTPIS SDNEAGYFDLLVKAYPQGNISKYLTTLKIGDTMKVRGPKGAMVYTPNMCRHIGMIAGGTG ITPMLQIIKAVIRNRPRNGGNDTTKLDLIFANVNPDDILLKEELDKLAAEDPDFNIYYVL NNPPQGWTGGVGFVTPEMIKEHLPAPASDVKILLCGPPPMISAMKKATESLGYTKARPVS KLEDQVFCF
Uniprot No.

Target Background

Function
Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of NADH-cytochrome b5 reductase 1 in Neosartorya fischeri?

NADH-cytochrome b5 reductase 1 (cbr1) in Neosartorya fischeri catalyzes the reduction of cytochrome b5 using NADH as an electron donor. This enzyme belongs to a well-characterized family of oxidoreductases that play crucial roles in various electron transfer processes. Similar to homologous proteins in other organisms, Neosartorya fischeri cbr1 likely participates in multiple metabolic pathways including fatty acid desaturation, sterol biosynthesis, and xenobiotic metabolism. Based on studies of related cytochrome b5 reductases, this enzyme facilitates the reduction of hydroxylamine compounds to their parent structures, which has implications for detoxification processes . The specific activity profile of Neosartorya fischeri cbr1 may include unique substrate preferences compared to homologs in other species.

How can researchers identify and characterize cbr1 expression in Neosartorya fischeri samples?

Identifying and characterizing cbr1 expression in Neosartorya fischeri requires a multi-technique approach:

  • Transcript detection: RT-PCR or RNA-Seq analysis targeting the CYB5R3 ortholog in Neosartorya fischeri

  • Protein detection: Western blotting using antibodies against conserved cytochrome b5 reductase epitopes

  • Activity assays: Spectrophotometric measurement of NADH oxidation or cytochrome b5 reduction

  • Localization studies: Subcellular fractionation followed by enzymatic assays or immunoblotting

For quantitative analysis, researchers should employ semi-quantitative immunoblotting techniques as described in hydroxylamine reduction studies, where protein expression levels are correlated with enzymatic activity . A combined approach using both protein quantification and activity measurements provides the most comprehensive characterization.

What structural features distinguish Neosartorya fischeri cbr1 from other fungal cytochrome b5 reductases?

While the crystal structure of Neosartorya fischeri cbr1 has not been fully characterized in the available literature, comparative analysis with homologous proteins suggests:

  • A conserved FAD-binding domain in the N-terminal region

  • A NADH-binding domain in the C-terminal region

  • A catalytic domain containing key residues involved in electron transfer

Neosartorya fischeri cbr1 is expected to share significant structural similarity with other fungal cytochrome b5 reductases, particularly from Aspergillus species, given their phylogenetic relationship. The strain specificity (ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) may confer unique properties to this particular variant .

What expression systems yield optimal production of active recombinant Neosartorya fischeri cbr1?

For optimal expression of recombinant Neosartorya fischeri cbr1, consider the following methodologies:

Expression SystemAdvantagesLimitationsYield Expectation
E. coli (BL21 DE3)High yield, cost-effective, rapid growthPotential for inclusion bodies, lack of post-translational modifications10-30 mg/L culture
Pichia pastorisProper protein folding, post-translational modifications, high cell densityLonger expression time, more complex media requirements50-100 mg/L culture
Aspergillus expression systemsNative-like post-translational modifications, proper foldingLower yields, complex purification5-15 mg/L culture
Mammalian cell linesComplex folding capability, mammalian-like modificationsExpensive, time-consuming, lower yields1-5 mg/L culture

For most research applications, the E. coli system with optimization for soluble expression (lower induction temperature of 16-18°C, reduced IPTG concentration of 0.1-0.5 mM) offers the best balance of yield and functionality. Adding a fusion tag (His6, GST, or MBP) facilitates purification while potentially enhancing solubility. For studies requiring native-like enzyme characteristics, the Pichia pastoris system may be preferable despite longer expression times.

What purification strategy maintains highest enzymatic activity of recombinant Neosartorya fischeri cbr1?

A multi-step purification strategy preserving enzymatic activity typically includes:

  • Initial capture: Affinity chromatography using nickel-NTA (for His-tagged protein) or glutathione-sepharose (for GST-tagged protein)

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 7.5-8.0)

  • Polishing: Size exclusion chromatography

Critical parameters for maintaining activity include:

  • Buffer composition: 50 mM phosphate or Tris buffer (pH 7.2-7.5) supplemented with 10% glycerol and 1 mM DTT

  • Temperature control: Maintaining 4°C throughout purification

  • Inclusion of FAD (1-5 μM) in purification buffers to prevent cofactor loss

  • Avoiding freeze-thaw cycles and extended storage at room temperature

When assessing purification efficiency, researchers should monitor both protein purity (by SDS-PAGE) and specific enzymatic activity to ensure that the purification process preserves functional integrity.

How does Neosartorya fischeri cbr1 contribute to hydroxylamine reduction pathways?

NADH-cytochrome b5 reductase, in conjunction with cytochrome b5, plays a crucial role in the reduction of various hydroxylamine compounds. Based on studies of hydroxylamine reduction in human liver microsomes, we can infer similar mechanisms in fungal systems. The b5/b5R system catalyzes the reduction of hydroxylamine compounds (such as sulfamethoxazole hydroxylamine) to their parent compounds, which is important for detoxification .

The proposed mechanism involves:

  • NADH binding to cytochrome b5 reductase

  • Electron transfer from NADH to the FAD cofactor in b5R

  • Electron transfer from reduced FAD to the heme group in cytochrome b5

  • Electron transfer from reduced cytochrome b5 to the hydroxylamine substrate

Studies have shown a 19-fold range of individual variability in hydroxylamine reduction activity in human liver microsomes (0.06–1.11 nmol/min/mg protein), with a 17-fold range in efficiency (Vmax/Km) among outliers . This variability correlates with b5 and b5R protein expression levels, suggesting that similar variability might exist in fungal systems depending on expression levels of cbr1 and cytochrome b5.

What is the relationship between cbr1 genetic variations and enzyme activity?

Studies on human cytochrome b5 reductase have identified several single nucleotide polymorphisms (SNPs) that significantly affect enzymatic activity. Specifically, two novel CYB5R3 SNPs, R59H and R297H, displayed atypical hydroxylamine reduction kinetics and decreased reduction efficiency . In CYB5A (the gene encoding cytochrome b5), a novel SNP (S5A) was associated with very low activity and protein expression .

For Neosartorya fischeri cbr1, researchers should consider:

  • Identifying conserved residues by sequence alignment with human CYB5R3

  • Targeting these conserved residues for site-directed mutagenesis

  • Investigating the effects of mutations on:

    • Protein expression levels

    • Enzyme kinetics (Km, Vmax, catalytic efficiency)

    • Substrate specificity

    • Protein stability

Experimental approaches should include:

  • Recombinant expression of wild-type and mutant variants

  • Comparative kinetic analysis

  • Thermal stability assessments

  • Spectroscopic characterization of cofactor binding

How can researchers optimize activity assays for recombinant Neosartorya fischeri cbr1?

Optimal activity assays for recombinant Neosartorya fischeri cbr1 require careful consideration of reaction conditions:

ParameterRecommended RangeOptimization Notes
pH7.0-7.5Conduct pH profiling in 0.2 unit increments
Temperature25-30°CBalance between activity and stability
NADH concentration10-500 μMEnsure saturation without inhibition
Electron acceptorCytochrome b5 (1-10 μM) or K3Fe(CN)6 (0.1-1.0 mM)Natural vs. artificial acceptor
Buffer50-100 mM phosphate or TrisInclude 0.1 mM EDTA to chelate trace metals
Reaction time1-10 minutesEnsure linearity throughout measurement period

Based on studies with human liver microsomes, researchers can employ the following assay methods:

  • Direct monitoring of NADH oxidation: Measuring the decrease in absorbance at 340 nm

  • Cytochrome b5 reduction: Monitoring the increase in absorbance at 424 nm

  • Hydroxylamine reduction assays: Quantifying parent compound formation by HPLC or LC-MS/MS

For accurate kinetic characterization, multiple substrate concentrations should be tested to determine Km and Vmax values using appropriate enzyme kinetic models.

How can researchers address inconsistent activity of recombinant Neosartorya fischeri cbr1?

Inconsistent activity of recombinant Neosartorya fischeri cbr1 can stem from multiple factors:

  • Cofactor loss during purification: Supplement purification buffers with 1-5 μM FAD

  • Oxidative damage: Include reducing agents (1-2 mM DTT or 5 mM β-mercaptoethanol) in storage buffers

  • Protein aggregation: Add 10% glycerol to storage buffers and avoid freeze-thaw cycles

  • Proteolytic degradation: Include protease inhibitors during cell lysis and early purification steps

  • Batch-to-batch variability: Standardize expression conditions and use internal controls

When troubleshooting activity issues, systematically evaluate:

  • Protein purity by SDS-PAGE

  • Oligomeric state by native PAGE or size exclusion chromatography

  • Cofactor binding by UV-visible spectroscopy (FAD absorption)

  • Storage conditions impact on activity retention

For longer-term storage, aliquot the purified enzyme and store at -80°C with 20% glycerol as a cryoprotectant.

What approaches help researchers analyze conflicting kinetic data for Neosartorya fischeri cbr1?

When confronted with conflicting kinetic data for recombinant Neosartorya fischeri cbr1, researchers should:

  • Normalize enzyme concentrations: Use active site titration or standardized activity assays

  • Apply multiple kinetic models: Compare Michaelis-Menten, Hill, and allosteric models

  • Consider substrate inhibition: Test wide substrate concentration ranges

  • Examine buffer effects: Compare activity in different buffer systems

  • Assess product inhibition: Include product removal systems or measure initial rates only

Statistical approaches should include:

  • Replicate measurements (minimum n=3) for each experimental condition

  • Nonlinear regression analysis rather than linearization methods

  • Residual analysis to identify systematic deviations

  • F-tests to compare goodness-of-fit between different kinetic models

When reporting kinetic parameters, include confidence intervals rather than just mean values. Multiple regression analysis, as used in hydroxylamine reduction studies, can help identify factors contributing to variability in enzymatic activity .

How does Neosartorya fischeri cbr1 compare to cytochrome b5 reductases from pathogenic fungi?

Comparative analysis of Neosartorya fischeri cbr1 with cytochrome b5 reductases from pathogenic fungi provides valuable insights:

OrganismSequence SimilarityActivity ProfilePhysiological Role
Neosartorya fischeriReferenceHydroxylamine reduction, electron transportSecondary metabolism, detoxification
Candida albicansModerate (~60-70%)Narrower substrate rangeAzole resistance, ergosterol biosynthesis
Aspergillus fumigatusHigh (~85-95%)Similar to N. fischeriSecondary metabolism, stress response
Cryptococcus neoformansLow (~45-55%)Different cofactor requirementsMelanin biosynthesis, virulence

Studies on Candida albicans have shown that mutations in genes related to electron transport can affect antifungal susceptibility. For example, mutations in phosphoinositide 5-phosphatase (INP51) and alkaline-responsive transcriptional regulator RIM101 were observed in fluconazole-resistant strains . While these specific genes are not directly related to cytochrome b5 reductase, they highlight the importance of redox systems in antifungal resistance mechanisms.

The unique evolutionary position of Neosartorya fischeri makes its cbr1 enzyme valuable for understanding the adaptation of redox systems across fungal species.

What potential applications exist for recombinant Neosartorya fischeri cbr1 in biotechnology?

Recombinant Neosartorya fischeri cbr1 has several potential biotechnological applications:

  • Biocatalysis: Hydroxylamine reduction for pharmaceutical synthesis

  • Biosensors: Development of NADH/NAD+ ratio sensors

  • Enzyme evolution studies: Model system for directed evolution of reductases

  • Antifungal drug development: Target for structure-based drug design

  • Bioremediation: Reduction of nitrogen-containing environmental pollutants

For biocatalytic applications, immobilization strategies can enhance enzyme stability and reusability. Techniques such as:

  • Covalent attachment to functionalized resins

  • Encapsulation in sol-gel matrices

  • Cross-linked enzyme aggregates (CLEAs)

  • Magnetic nanoparticle conjugation

have been successfully applied to similar oxidoreductases and could be adapted for Neosartorya fischeri cbr1.

For antifungal development applications, the significant difference between fungal and human cytochrome b5 reductases could be exploited to design selective inhibitors. Recent research on antifungal proteins from Neosartorya fischeri, like NFAP2, demonstrates the unique properties of proteins from this organism and their potential applications in treating fungal infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.