Recombinant Neosartorya fischeri NADH-cytochrome b5 reductase 2 (mcr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mcr1; NFIA_020210; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
mcr1
Target Protein Sequence
MFARQSLRFAQPLKQGFRKYSTEAPSKGKSSLAPIYVAVGLTGLGVGLYRYNSASAEAPP AERPKVFTGGDQGWVDLKLAQIENLSPNTKRLRFEFPDKEAVSGLHVASALLTKFKPHGA EKPVIRPYTPVSDEEQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWEANK HKHICLIAGGTGITPMYQLARKIFKDPEDQTKVTLVFGNVREEDILLKKELQELENTYPR RFRAFYVLDHPPKEWTGGKGYITKELLKTVLPEPKEENIKIFVCGPPGMYKSISGPKVSP KDQGELTGILAELGYSKDQVFKF
Uniprot No.

Target Background

Function
This protein may mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Neosartorya fischeri antifungal protein (NFAP) and how does it differ from NFAP2?

NFAP is a small, cysteine-rich, cationic protein produced by the ascomycete Neosartorya fischeri. It demonstrates inhibitory activity against various plant pathogenic filamentous ascomycetes with minimum inhibitory concentrations (MICs) ranging from 12.5 to 100 μg/ml . NFAP2, while also produced by N. fischeri, has a different amino acid sequence and specifically targets Candida species rather than filamentous fungi . Both proteins share the characteristic of being heat-stable and correctly folded in recombinant or synthetic forms. The key difference lies in their target specificity and the structural elements responsible for their antifungal activity.

What is the mechanism behind NADH-cytochrome b5 reductase (Mcr1p) dual localization in mitochondria?

Mcr1p is encoded by a single nuclear gene but is imported into two different submitochondrial compartments: the outer membrane and the intermembrane space. This dual targeting is determined by the amino-terminal 47 amino acids of the protein. The first 12 residues function as a weak matrix-targeting signal, while the remaining residues are predominantly hydrophobic and serve as an intramitochondrial sorting signal directing the protein to either the outer membrane or the intermembrane space . This bipartite targeting sequence mediates specific interactions with components of both mitochondrial translocation systems, which is essential for the correct localization of the protein.

How can researchers effectively produce recombinant NFAP or NFAP2 for experimental studies?

For NFAP2, researchers can employ a Penicillium chrysogenum-based expression system that yields approximately 40 times more protein than the native producer. Alternatively, solid-phase peptide synthesis combined with native chemical ligation can produce synthetic NFAP2 with a yield about 16 times higher than native production . For the P. chrysogenum expression system, researchers should use P. chrysogenum minimal medium (PCMM) containing 2% sucrose, 0.3% NaNO₃, 0.05% KCl, 0.05% MgSO₄ × 7 H₂O, 0.005% FeSO₄ × 7 H₂O, and other trace elements . The production method involves generating an expression vector where the cDNA sequence coding for mature NFAP2 is fused to a paf prepro sequence under the regulation of a strong paf-promoter.

What methodologies should be employed to assess the antifungal activity of NFAP and its peptide derivatives?

Researchers should implement a broth microdilution susceptibility assay to determine minimum inhibitory concentrations (MICs). This approach involves preparing two-fold dilution series of the antifungal protein or peptide derivatives in a suitable medium, inoculating with the test fungus (e.g., 5×10⁴ conidia/ml), and incubating at an appropriate temperature (typically 25°C for filamentous fungi) . Growth inhibition can be assessed by measuring absorbance at 620 nm after 72 hours. For more detailed analysis, researchers should calculate growth percentages compared to untreated controls to reveal dose-dependent activity. Light microscopy should be employed to visualize morphological changes in fungal structures following treatment . Testing should include multiple technical replicates and be repeated at least twice to ensure reliability.

How can functional domains in NFAP and NFAP2 be mapped efficiently?

Functional mapping of these antifungal proteins requires a systematic approach combining synthetic peptide fragments and antifungal activity assays. For NFAP2, research has shown that the mid-N-terminal part of the protein, rather than the evolutionarily conserved antimicrobial γ-core motif, influences antifungal activity . To map functional domains:

  • Design synthetic peptide fragments spanning different regions of the protein

  • Determine physicochemical properties of each fragment (see table below)

  • Test each fragment for antifungal activity against target fungi

  • Compare activity profiles to identify regions essential for function

Table 1: Example of Amino Acid Sequences and Properties of Protein Fragments

Protein/FragmentAmino Acid SequenceNet ChargeHydrophilicityAntifungal Activity
NFAP (full)(Full sequence)High positiveVariableEffective (12.5-100 μg/ml)
γNFAP(Core sequence)Low positiveVariableIneffective (>200 μg/ml)
γNFAP-opt(Optimized sequence)High positiveVariableEffective (12.5-100 μg/ml)

What techniques should be used to investigate conformational changes in antifungal proteins upon interaction with fungal targets?

Electronic circular dichroism (ECD) spectroscopy is the recommended method for monitoring structural changes when antifungal proteins interact with fungal cells . This technique allows researchers to detect conformational alterations that may occur during the protein's mechanism of action. The experimental approach should include:

  • Obtaining ECD spectra of the purified protein in buffer solution (baseline)

  • Recording spectra immediately after exposure to fungal conidia

  • Measuring spectra after 24-hour co-incubation with fungal cells

  • Comparing the three spectra to identify structural changes

Research with NFAP demonstrates that antifungal activity does not require conformational change of the β-pleated protein structure or the canonically ordered conformation of synthetic peptide derivatives . This finding contradicts the common assumption that antimicrobial peptides must undergo significant structural rearrangement to exert their effects.

How can synergistic effects between NFAP2 and conventional antifungals be quantified for potential clinical applications?

To quantify synergistic effects between NFAP2 and conventional antifungals like fluconazole, researchers should follow the CLSI-M27A3 susceptibility test method . This approach involves determining the minimum inhibitory concentrations of NFAP2 and the antifungal agent separately, then testing them in combination at various concentration ratios. The fractional inhibitory concentration index (FICI) can be calculated to determine whether the interaction is synergistic (FICI ≤ 0.5), additive (0.5 < FICI ≤ 1), indifferent (1 < FICI ≤ 4), or antagonistic (FICI > 4). Research has shown that recombinant NFAP2 interacts synergistically with fluconazole against Candida species, significantly decreasing the effective in vitro concentrations of fluconazole in RPMI 1640 medium, which mimics human inner fluid .

What factors influence the efficacy of NFAP and NFAP2 against different fungal species, and how should these be controlled in experimental designs?

Several factors significantly influence the efficacy of these antifungal proteins:

  • Medium composition: MICs are higher in RPMI 1640 (mimicking human inner fluid) than in low ionic strength media . Researchers should test activity in multiple media types relevant to the intended application.

  • Target fungal species: Sensitivity varies dramatically between species. NFAP inhibits plant pathogenic ascomycetes with MICs ranging from 12.5 to 100 μg/ml, while NFAP2 specifically targets Candida species .

  • Protein structure: The antifungal activity does not depend on conformational changes upon target binding, suggesting a specific molecular interaction rather than general membrane disruption .

  • Peptide charge and structure: For peptide derivatives, a high positive net charge correlates with antifungal efficacy, but hydrophilicity and primary structure have less influence .

Researchers should systematically control and report these variables when designing experiments to ensure reproducibility and accurate comparison between studies.

How do mutations in the targeting sequence of Mcr1p affect its submitochondrial localization and function?

Research on Mcr1p demonstrates that specific mutations in the hydrophobic region of its targeting sequence can dramatically alter protein localization. A double point mutation within this region virtually abolishes the protein's ability to insert into the outer mitochondrial membrane but increases the efficiency of transport into the intermembrane space . This finding suggests that the hydrophobic segment contains specific recognition elements for the outer membrane insertion machinery.

For proper transport into the intermembrane space, an electrochemical potential across the inner membrane and ATP in the matrix are required. Additionally, the import process is strongly impaired in mitochondria lacking Tom7p or Tim11p, which are components of the translocation machineries in the outer and inner mitochondrial membranes, respectively . These findings indicate that intramitochondrial sorting of the Mcr1 protein involves specific interactions between its bipartite targeting sequence and components of both mitochondrial translocation systems.

What safety assessments should be performed before using NFAP or NFAP2 in agricultural or clinical applications?

Comprehensive safety assessments should include:

  • Cytotoxicity testing: Research shows that NFAP and γNFAP-opt do not exhibit hemolysis or cytotoxicity when applied at antifungally effective concentrations in human cell lines .

  • Plant toxicity assessment: Testing with Medicago truncatula A-17 seedlings demonstrates that treatment with NFAP (400 μg/ml) and γNFAP-opt or γNFAP-optGZ (25 μg/ml) does not cause morphological aberrations, reduction in primary root length, or changes in the number of lateral roots .

  • Stability evaluation: Both recombinant and synthetic forms of these proteins maintain correct folding and heat stability, which is essential for practical applications .

  • Interaction with existing treatments: For clinical applications, potential interactions with conventional antifungal drugs should be assessed, as demonstrated by the synergistic effect between NFAP2 and fluconazole .

These safety assessments are critical steps before advancing to field trials or clinical studies, as they establish both efficacy and the absence of detrimental effects to the host organism or environment.

How can crop protection experiments be designed to validate the efficacy of NFAP against postharvest fungal pathogens?

To validate the efficacy of NFAP and its peptide derivatives against postharvest fungal pathogens like Cladosporium herbarum, researchers should implement controlled experiments using actual crop specimens. Research has demonstrated that NFAP and its antifungally active γ-core peptide derivatives can protect tomato fruits against C. herbarum . A robust experimental design should include:

  • Preparation of fresh, uniform crop specimens (e.g., tomato fruits)

  • Surface sterilization to eliminate existing microorganisms

  • Treatment groups including:

    • Negative control (untreated)

    • Positive control (conventional fungicide)

    • Test groups with different concentrations of NFAP or derivatives

  • Inoculation with a standardized spore suspension of the target pathogen

  • Incubation under controlled temperature and humidity conditions

  • Assessment of disease development using:

    • Visual inspection and scoring of symptoms

    • Quantification of fungal biomass

    • Measurement of disease severity indices

  • Statistical analysis comparing treatment efficacy

Colony-forming unit (CFU) counts should be performed to quantify viable fungal cells following treatment, as demonstrated in Table 3 of the referenced study .

What molecular modifications to NFAP or NFAP2 might enhance their antifungal efficacy or spectrum?

Based on current research, several promising molecular modifications could enhance the efficacy or spectrum of these antifungal proteins:

  • Optimization of the γ-core region: Although the native γ-core of NFAP (γNFAP) is ineffective (MIC >200 μg/ml), the optimized variant γNFAP-opt shows significant activity against Botrytis, Cladosporium, and Fusarium isolates (MIC range: 12.5-100 μg/ml) . This suggests that further optimization of this region could expand the activity spectrum.

  • Charge modification: Research indicates that a high positive net charge correlates with antifungal efficacy more strongly than hydrophilicity or primary structure . Increasing the positive charge through site-directed mutagenesis could potentially enhance activity.

  • Mid-N-terminal modifications: For NFAP2, the mid-N-terminal part influences antifungal activity more than the conserved γ-core motif . Targeted modifications of this region might improve efficacy against resistant strains.

  • Creation of chimeric proteins: Combining functional domains from different antifungal proteins could potentially create novel molecules with broader spectrum activity or enhanced potency against specific pathogens.

These modifications should be systematically tested using the production methods and activity assays described in previous sections.

What advanced structural analysis techniques would provide insights into the mechanism of action of these proteins?

Nuclear magnetic resonance (NMR) spectroscopy represents an ideal technique for structural analysis of these antifungal proteins. Preliminary NMR measurements indicate that recombinant NFAP2 is suitable for detailed structural investigations . To gain comprehensive insights into structure-function relationships, researchers should employ:

  • Solution NMR spectroscopy: To determine the three-dimensional structure of the proteins in solution, potentially using 13C/15N-labeled recombinant proteins produced with 0.3% (w/v) Na15NO3 and 1% (w/v) 13C-glucose as nitrogen and carbon sources, respectively .

  • Solid-state NMR: To investigate the conformational changes and interactions of these proteins with fungal membrane components.

  • X-ray crystallography: To obtain high-resolution structural data complementary to NMR findings.

  • Molecular dynamics simulations: To model protein dynamics and interactions with potential target molecules.

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions involved in binding to fungal targets.

These advanced structural analyses would provide crucial insights into the mechanism of action, potentially identifying specific molecular interactions that could be targeted for rational design of improved antifungal agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.