Recombinant Neosartorya fischeri Patatin-like phospholipase domain-containing protein NFIA_019760 (NFIA_019760)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Neosartorya Fischeri Patatin-Like Phospholipase Domain-Containing Protein NFIA_019760

The recombinant Neosartorya fischeri Patatin-like phospholipase domain-containing protein NFIA_019760 (Cat.No. RFL32324NF) is a bioengineered protein expressed in E. coli with a His-tag for purification. It spans the full-length sequence (1–712 amino acids) and is lyophilized for storage. While its specific biological function remains under-characterized, its structural features and production parameters provide critical insights for research applications.

Patatin-Like Phospholipase Domain

Patatin-like domains are associated with enzymatic activity against phospholipids, though NFIA_019760’s specific substrate or catalytic role remains uncharacterized. Structural homologs include:

  1. Antifungal Proteins (e.g., NFAP): Cysteine-rich, cationic proteins from Neosartorya spp. with membrane-disrupting activity .

  2. Penicillium spp. Orthologs: Genome mining identifies similar proteins in Penicillium brasiliensis and P. oxalicum .

Distinguishing Features from NFAP

While NFAP (Neosartorya fischeri antifungal protein) shares a fungal origin, it differs in:

PropertyNFIA_019760NFAP
DomainPatatin-like phospholipaseCysteine-rich defensin-like
Length712 aa~50 aa
FunctionHypothetical lipid metabolismMembrane disruption, antifungal activity
Expression SystemE. coliNative/heterologous (Pichia pastoris)

Applications in Antimicrobial Studies

Though NFIA_019760’s antifungal activity is unconfirmed, its structural similarity to Patatin-like enzymes suggests potential roles in:

  • Lipid Metabolism: Interactions with fungal membranes or host lipid pathways.

  • Biocontrol Agents: Exploration in agriculture as a biofungicide adjunct (as seen with NFAP derivatives) .

Production Challenges

  • Yield Optimization: E. coli expression efficiency and solubility require further refinement.

  • Functional Validation: Enzymatic assays or knockout studies needed to confirm activity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
NFIA_019760; Patatin-like phospholipase domain-containing protein NFIA_019760
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-712
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
NFIA_019760
Target Protein Sequence
MTSDEKSATRDIYDPNTLPDYDREFIDPDDLRQFEKALNAPEAAPLVALNDWRPVNQRVR KSRRTKPRRSKDETREGVLYTVLKWPFLFTVFAWITVLGFAYTLTRLYIFLYEQFVTWRG KRERLRKELSMQTNYQDWLKAAQALDTYLGNLKWKETDEYAYYDHLTINKVVAQLKQTRK AAETEMQNGRSGLSDPPAVEELCFLLEACVKNNFAGVENPRLYSETYSGTKDLVQEYIDE VHSCIRLVLDSKQISNEDKYQFFKHLDTNFGRTALCLSGGATFAYYHFGVIRALLDNDVL PEIITGTSGGALVAALVATRTDEELKQLLVPALAHRIRACHEGFTTWVRRWWRTGARFDT LDWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHSPTILANYLTSPDCVIWSAVLA SAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTIVSQVN PHINLFFFNSRGSVGRPVTHRKGRGWRGGFLGSAIEQYIKLDMNKWLRVLRHLELLPRPL GQDWSEIWLQKFSGTITIWPKSIPSDFYHILSDPSPERLARMLHVGKQSAFPKIQFIKNR LKIENAIMQGLQQCSSGGGRVMSPILSRRRQDRAEEHADRMVERLDQSFPERQSDYKDES HYTEVSDSLSATSSRPHTPDARRSSMFEEMRRQSAVFFDDSDMYADEDAVTT
Uniprot No.

Target Background

Function

Probable lipid hydrolase.

Database Links
Protein Families
PLPL family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural organization of NFIA_019760 and how does it compare to other patatin-like phospholipases?

NFIA_019760 is characterized by its patatin domain, which typically exhibits a α/β hydrolase fold with a conserved catalytic dyad. The protein contains the characteristic G-x-S-x-G motif found in patatin domains, where serine serves as part of the catalytic dyad alongside an aspartate residue. While specific structural data for NFIA_019760 is limited, comparative analysis with homologous proteins suggests that it likely possesses a central β-sheet surrounded by α-helices, with the catalytic residues positioned within a substrate-binding pocket that accommodates phospholipid substrates.

Unlike canonical phospholipases that utilize a catalytic triad, patatin-like phospholipases employ a serine-aspartate dyad mechanism that influences their substrate specificity and catalytic properties. This structural arrangement enables them to hydrolyze the sn-1 or sn-2 position of phospholipids with varying specificities depending on the exact architecture of the binding pocket.

When comparing NFIA_019760 with other fungal patatin-like phospholipases, sequence alignment reveals approximately 40-60% identity with homologs from related Aspergillus species, while maintaining the essential catalytic motifs necessary for phospholipase activity .

What are the recommended expression systems for recombinant NFIA_019760 production?

For initial expression studies of NFIA_019760, heterologous expression in fungal systems is highly recommended based on experience with other proteins from Neosartorya fischeri. Drawing from successful approaches with NFAP (Neosartorya fischeri antifungal protein), Aspergillus nidulans represents an excellent expression host, utilizing a pAMA1-based autonomous replicative vector construct as demonstrated in previous studies .

For researchers preferring yeast-based systems, Pichia pastoris offers advantages for proteins requiring eukaryotic post-translational modifications. When working with P. pastoris, use of the strong inducible AOX1 promoter with the α-factor secretion signal facilitates efficient expression and secretion into the culture medium.

If bacterial expression is preferred, E. coli BL21(DE3) with pET-based vectors can be attempted, but be aware that patatin-domain proteins often present folding challenges in prokaryotic systems. In such cases, expression as fusion proteins with solubility enhancers like MBP, SUMO, or thioredoxin is advisable.

Regardless of the chosen system, incorporating affinity tags at both N- and C-termini is recommended to facilitate purification and distinction between full-length protein and truncated products during purification .

How can the enzymatic activity of recombinant NFIA_019760 be confirmed?

Confirming the enzymatic activity of recombinant NFIA_019760 requires a multi-faceted approach utilizing both general and specific phospholipase assays. Initial screening should employ colorimetric substrates such as para-nitrophenyl palmitate (pNPP), which produces a yellow chromophore (para-nitrophenol) upon hydrolysis that can be measured at 405-410 nm.

For more specific phospholipase activity confirmation, fluorescence-based assays using BODIPY-labeled or NBD-labeled phospholipid substrates provide enhanced sensitivity and specificity. Commercially available kits such as EnzChek Phospholipase A2 Assay Kit offer standardized protocols for initial activity screening.

When confirming activity, it's essential to test various reaction conditions, as enzymatic activity may be significantly affected by buffer composition, pH, and the presence of cations. Based on studies with other Neosartorya fischeri proteins, mono- and divalent cations (50-100 mM KCl, MgSO4, Na2SO4) may significantly influence enzymatic activity .

A comprehensive activity profile should include:

Assay TypeSubstrate ExamplesDetection MethodKey Parameters
ColorimetricpNPP, 4-methylumbelliferyl palmitateSpectrophotometrypH 7.0-8.0, 37°C
FluorometricPED6, BODIPY-phospholipidsFluorescenceEx/Em specific to fluorophore
Radiometric[14C]-labeled phospholipidsScintillation countingVaried substrate concentrations
LC-MS/MSNatural phospholipidsMass spectrometryProduct identification

The ability to hydrolyze phospholipid substrates with concomitant release of fatty acids provides definitive confirmation of phospholipase activity in your recombinant NFIA_019760 preparation .

What experimental design approaches are most effective for characterizing NFIA_019760's substrate specificity?

For rigorous characterization of NFIA_019760's substrate specificity, a systematic experimental design incorporating both control and experimental groups is essential. Following the principles outlined in experimental design literature, a comprehensive approach should include the following elements :

A classic experimental design with randomized groups should be implemented:

  • Control groups: Reaction mixtures containing substrates without enzyme

  • Experimental groups: Identical reaction mixtures with purified NFIA_019760

  • Multiple technical and biological replicates to ensure statistical significance

Substrate specificity should be investigated using a panel of structurally diverse phospholipids varying in:

  • Head group composition (PC, PE, PS, PI, PG)

  • Acyl chain length (C8-C22)

  • Saturation level (saturated, monounsaturated, polyunsaturated)

  • Positional isomers (sn-1 vs. sn-2 substituted phospholipids)

For quantitative analysis, kinetic parameters should be determined for each substrate using a concentration series ranging from 0.1-10× the estimated Km value. Plot initial reaction velocities against substrate concentration and analyze using non-linear regression to determine Km, Vmax, and kcat values.

Additional experimental variations should include testing activity under different pH conditions (pH 5.0-9.0), temperature ranges (25-50°C), and in the presence of various cations and potential cofactors, as these have been shown to significantly affect the activity of other Neosartorya fischeri enzymes .

By implementing this systematic approach with appropriate controls and randomization, you can establish a comprehensive substrate specificity profile for NFIA_019760 and determine its preference within the phospholipid family.

How should gene knockout/knockdown experiments be designed to study NFIA_019760 function in Neosartorya fischeri?

Designing effective gene knockout/knockdown experiments for NFIA_019760 requires careful planning and appropriate controls following experimental design principles. The following approach is recommended based on established experimental methodology :

First, select the appropriate gene modification strategy:

  • CRISPR/Cas9-mediated deletion for complete knockout

  • RNAi-based knockdown for partial reduction in expression

  • Inducible promoter systems for temporal control of expression

For a robust experimental design, implement the following groups:

  • Experimental group: NFIA_019760 knockout/knockdown strain

  • Control group 1: Wild-type N. fischeri (no genetic modification)

  • Control group 2: N. fischeri with non-targeting gRNA or scrambled RNAi (procedural control)

  • Complementation group: Knockout strain with reintroduced NFIA_019760 (for validation)

Phenotypic analysis should be comprehensive, including:

  • Growth rate measurements under standard conditions and various stresses

  • Morphological examination (hyphal development, conidiation, germination rates)

  • Lipidomic analysis to detect changes in membrane composition

  • Transcriptomic analysis to identify compensatory mechanisms

For functional validation, the Solomon 4-Group Design could be implemented, combining groups with and without pre-testing to account for potential measurement effects . This would involve:

  • Group 1: Wild-type with pre-test and post-test

  • Group 2: Knockout with pre-test and post-test

  • Group 3: Wild-type with post-test only

  • Group 4: Knockout with post-test only

Confirming successful knockout/knockdown requires multiple verification methods:

  • PCR verification of genomic modification

  • RT-qPCR for transcript level analysis

  • Western blotting for protein level confirmation

  • Enzymatic activity assays for functional validation

This systematic approach with appropriate controls will establish causality between NFIA_019760 and observed phenotypes, providing insights into its physiological role in N. fischeri .

What approaches should be used to analyze contradictory data regarding NFIA_019760's enzymatic mechanism?

When confronted with contradictory data regarding NFIA_019760's enzymatic mechanism, a systematic troubleshooting approach grounded in rigorous experimental design principles is essential. The following methodology is recommended:

  • Standardization of experimental procedures:

    • Ensure consistent protein preparation methodologies across laboratories

    • Verify protein integrity and homogeneity by SDS-PAGE, mass spectrometry, and dynamic light scattering

    • Standardize buffer compositions, substrate preparations, and assay conditions

  • Implement multi-technique verification:

    • Apply orthogonal activity assays (colorimetric, fluorometric, and mass spectrometric)

    • Perform direct product analysis using HPLC or LC-MS/MS to unambiguously identify reaction products

    • Conduct mechanistic studies using substrate analogs and specific inhibitors

  • Systematically investigate potential variables:

    • Effect of mono- and divalent cations that have been shown to significantly affect the activity of other N. fischeri enzymes

    • pH-dependent activity profiles to identify optimal conditions and mechanistic transitions

    • Temperature effects on both stability and catalytic parameters

  • Apply site-directed mutagenesis to test mechanistic hypotheses:

    • Mutate predicted catalytic residues (serine and aspartate in the catalytic dyad)

    • Create alanine-scanning mutants of substrate-binding pocket residues

    • Analyze kinetic parameters of mutants to identify essential catalytic residues

  • Implement computational modeling:

    • Molecular dynamics simulations of enzyme-substrate complexes

    • QM/MM calculations to model transition states

    • Docking studies with various substrates to predict binding modes

By applying these approaches within a properly controlled experimental design framework, contradictory data can often be reconciled through identification of critical variables that affect enzymatic mechanism . Document all experimental conditions meticulously to facilitate cross-laboratory verification and replication.

What is the optimal protocol for heterologous expression and purification of NFIA_019760?

Based on experience with similar fungal proteins, the following optimized protocol is recommended for heterologous expression and purification of NFIA_019760:

Expression Protocol:

For expression in Aspergillus nidulans (recommended based on success with other N. fischeri proteins):

  • Transform A. nidulans CS2902 with a pAMA1-based replicative vector containing the nfap gene under control of a strong constitutive promoter (e.g., gpdA)

  • Inoculate transformants into complete medium and incubate at 37°C with shaking (200 rpm) for 48-72 hours

  • Monitor expression by taking small aliquots at 24-hour intervals for Western blot analysis

  • Harvest mycelia by filtration when expression reaches optimal levels (typically 48-72 hours)

For bacterial expression (alternative approach):

  • Transform E. coli BL21(DE3) with pET-based vector containing NFIA_019760 fused to a solubility tag (SUMO or MBP)

  • Grow cultures at 37°C to OD600 of 0.6-0.8

  • Induce with 0.1-0.5 mM IPTG

  • Shift temperature to 16-18°C and continue cultivation for 16-18 hours

  • Harvest cells by centrifugation at 5000 × g for 15 minutes

Purification Protocol:

  • Cell Lysis:

    • For fungal cells: Grind in liquid nitrogen followed by buffer extraction

    • For bacterial cells: Sonication or pressure-based disruption in lysis buffer

  • Affinity Chromatography:

    • For His-tagged constructs: IMAC using Ni-NTA resin

    • Equilibrate column with buffer containing 25 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Apply clarified lysate

    • Wash with buffer containing 20-30 mM imidazole

    • Elute with gradient to 250 mM imidazole

  • Tag Removal (if necessary):

    • Add TEV or PreScission protease (1:50 ratio to target protein)

    • Incubate at 4°C overnight

    • Remove cleaved tag by reverse IMAC

  • Polishing Steps:

    • Size exclusion chromatography using Superdex 75 or 200 in buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol

    • Ion exchange chromatography if further purification is needed

Throughout purification, include mono- and divalent cations (50-100 mM KCl, MgSO4) in buffers, as these have been shown to significantly affect the stability and activity of similar proteins from N. fischeri .

Final quality control should include SDS-PAGE, Western blot, mass spectrometry, and activity assays to confirm identity, purity, and functionality of the purified protein .

What analytical techniques should be employed to characterize the structural features of NFIA_019760?

A comprehensive structural characterization of NFIA_019760 requires a multi-technique approach targeting different aspects of protein structure:

Primary Structure Analysis:

  • Mass Spectrometry:

    • Intact mass measurement by ESI-MS or MALDI-TOF for molecular weight confirmation

    • Peptide mass fingerprinting following tryptic digestion

    • MS/MS sequencing for confirmation of post-translational modifications

  • N-terminal Sequencing:

    • Edman degradation to confirm the N-terminal sequence

    • Analysis for potential signal peptide cleavage sites

Secondary Structure Analysis:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) to estimate α-helix and β-sheet content

    • Thermal denaturation profiles to assess structural stability

    • Effects of pH and salt concentration on secondary structure

  • Fourier Transform Infrared Spectroscopy (FTIR):

    • Analysis of amide I band (1600-1700 cm⁻¹) for secondary structure elements

    • Complementary to CD for β-sheet content estimation

Tertiary Structure Analysis:

  • X-ray Crystallography:

    • Crystallization screening using commercial kits

    • Optimization of crystallization conditions for diffraction-quality crystals

    • Data collection at synchrotron facilities for high-resolution structures

  • NMR Spectroscopy:

    • 2D heteronuclear experiments (¹⁵N-HSQC) for backbone assignments

    • 3D experiments for side-chain assignments

    • Analysis of chemical shift perturbations upon substrate binding

  • Small-Angle X-ray Scattering (SAXS):

    • Low-resolution envelope determination

    • Analysis of protein flexibility and conformation in solution

    • Complementary to crystallography for dynamic regions

Quaternary Structure Analysis:

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determination of oligomeric state and molecular weight in solution

    • Analysis of concentration-dependent oligomerization

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments for homogeneity assessment

    • Sedimentation equilibrium for accurate molecular weight determination

For structural comparison with other patatin-like phospholipases, computational approaches including homology modeling and molecular dynamics simulations should be employed when experimental structures are not available .

What are the most sensitive assays for measuring NFIA_019760 phospholipase activity and kinetic parameters?

For rigorous characterization of NFIA_019760's phospholipase activity, a combination of sensitive assays is recommended to determine accurate kinetic parameters:

Fluorescence-Based Assays:

  • FRET-Based Phospholipid Substrates:

    • Substrates with fluorophore-quencher pairs that separate upon hydrolysis

    • Real-time continuous monitoring of activity

    • High sensitivity (detection limit: 0.1-1 ng of enzyme)

    • Example: PED6 (Invitrogen) with excitation at 485 nm and emission at 516 nm

  • NBD-Labeled Phospholipids:

    • Substrates with fluorescent NBD group at acyl chains

    • Changes in fluorescence intensity upon hydrolysis

    • Good for substrate specificity determination

    • Compatible with plate reader formats for high-throughput analysis

Mass Spectrometry-Based Assays:

  • LC-MS/MS:

    • Direct detection of substrate depletion and product formation

    • Unambiguous identification of reaction products

    • Multiple reaction monitoring (MRM) for quantification

    • Ability to detect regiospecificity (sn-1 vs. sn-2 hydrolysis)

  • MALDI-TOF:

    • Rapid analysis of reaction products

    • Suitable for endpoint measurements

    • Lower throughput but excellent for initial characterization

Kinetic Parameter Determination:

  • Initial Velocity Measurements:

    • Substrate concentration series (typically 0.1-10× Km)

    • Measurement of initial rates (<10% substrate conversion)

    • Non-linear regression analysis using Michaelis-Menten equation:
      v=Vmax×[S]Km+[S]v = \frac{V_{max} \times [S]}{K_m + [S]}

  • Inhibition Studies:

    • Competitive inhibitors for active site characterization

    • Dixon plots for inhibition constant (Ki) determination

    • Progress curve analysis for slow-binding inhibitors

  • pH-Rate Profiles:

    • Activity measurements across pH range (pH 5-9)

    • Determination of optimal pH and catalytic pKa values

    • Insights into catalytic mechanism

The effect of mono- and divalent cations should be systematically evaluated, as these have been shown to significantly influence the activity of other enzymes from N. fischeri . Include 50-100 mM concentrations of KCl, MgSO4, and Na2SO4 in your screening conditions.

For high-precision measurements, consider a coupled enzyme assay system where the product of NFIA_019760 activity (e.g., free fatty acid) is linked to a secondary enzymatic reaction with easily detectable output .

What strategies can address common challenges in obtaining active recombinant NFIA_019760?

Researchers frequently encounter challenges when working with recombinant patatin-like phospholipases like NFIA_019760. The following strategies address the most common issues:

Poor Expression/Solubility:

  • Expression System Optimization:

    • If bacterial expression yields inclusion bodies, switch to fungal hosts like Aspergillus nidulans which has proven successful for other N. fischeri proteins

    • Use strong inducible promoters with careful optimization of induction conditions

    • Lower cultivation temperature (16-20°C) to slow protein synthesis and improve folding

  • Fusion Partner Strategies:

    • Incorporate solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Add tags to both N- and C-termini to facilitate identification of full-length protein

    • Consider periplasmic targeting in bacterial systems using pelB signal sequence

Protein Instability/Degradation:

  • Buffer Optimization:

    • Screen various pH conditions (typically pH 6.0-8.0)

    • Include stabilizing additives (5-10% glycerol, 1-5 mM DTT, 0.1% non-ionic detergents)

    • Add mono- and divalent cations (50-100 mM KCl, MgSO4, Na2SO4) which have shown stabilizing effects for other N. fischeri proteins

  • Protease Protection:

    • Include comprehensive protease inhibitor cocktails during all purification steps

    • Reduce purification time by optimizing protocols

    • Remove potential protease-sensitive regions through protein engineering

Loss of Activity:

  • Cofactor Supplementation:

    • Screen for essential metal ions (Ca²⁺, Mg²⁺, Zn²⁺) at various concentrations

    • Test lipid cofactors that might be required for structural integrity

    • Include reducing agents to maintain cysteine residues in reduced state if present in active site

  • Refolding Strategies:

    • For proteins trapped in inclusion bodies, develop on-column refolding protocols

    • Use gradual dialysis to remove denaturants (8M to 0M urea in 1M steps)

    • Screen refolding additives (L-arginine, sucrose, cyclodextrins)

Troubleshooting Decision Tree:

Observed IssueDiagnostic TestPotential Solutions
No expressionWestern blot of whole cellsCodon optimization, alternative host
Insoluble expressionSolubility fractionationLower temperature, fusion tags
Protein degradationTime-course Western blotProtease inhibitors, N/C terminal tags
Purified but inactiveActivity assays with varied conditionsBuffer screening, cofactor addition
Active but unstableThermal shift assayStabilizing additives, storage optimization

By systematically applying these strategies with careful documentation of outcomes, researchers can overcome common challenges in working with recombinant NFIA_019760 .

How can researchers overcome difficulties in crystallizing NFIA_019760 for structural studies?

Crystallizing patatin-like phospholipases like NFIA_019760 presents specific challenges due to their flexible domains and hydrophobic surfaces. The following comprehensive approach can help overcome these difficulties:

Pre-crystallization Optimization:

  • Construct Engineering:

    • Create truncated variants removing flexible termini

    • Design surface entropy reduction mutations (replacing clusters of high-entropy residues like Lys, Glu with Ala)

    • Consider fusion to crystallization chaperones (T4 lysozyme, BRIL)

  • Sample Homogeneity Enhancement:

    • Employ multiple chromatography steps (affinity, ion exchange, size exclusion)

    • Verify monodispersity by dynamic light scattering (DLS, target PDI <0.1)

    • Use thermal shift assays to identify stabilizing buffer conditions

    • Remove heterogeneity from post-translational modifications by expression in minimal systems

Crystallization Screening Strategies:

  • Initial Screening Approach:

    • Start with sparse matrix screens at multiple protein concentrations (5-20 mg/mL)

    • Test both vapor diffusion (sitting and hanging drop) and batch crystallization methods

    • Implement temperature variations (4°C, 16°C, 20°C)

    • Include mono- and divalent cations shown to stabilize other N. fischeri proteins

  • Advanced Screening Techniques:

    • Use microseeding to promote crystal nucleation

    • Implement counter-diffusion methods for slower equilibration

    • Try lipidic cubic phase (LCP) for proteins with hydrophobic surfaces

    • Explore crystallization with antibody fragments (Fab, nanobodies)

  • Additive Strategies:

    • Screen with substrate analogs or inhibitors to stabilize active site

    • Try chemical crosslinking to reduce conformational flexibility

    • Use amphiphiles (detergents, lipids) to mimic membrane environment

    • Include cryoprotectants (glycerol, PEG 400) directly in crystallization conditions

Alternative Approaches When Crystallization Fails:

  • NMR Spectroscopy:

    • Prepare isotopically labeled samples (¹⁵N, ¹³C, ²H)

    • Focus on solution structure of individual domains

    • Use methyl-TROSY approaches for larger constructs

  • Cryo-electron Microscopy:

    • Consider Cryo-EM for full-length protein or complexes

    • Use Volta phase plates for enhanced contrast

    • Attempt particle enlargement strategies (e.g., symmetric assemblies)

  • Computational Modeling:

    • Leverage AlphaFold2 or RoseTTAFold predictions

    • Validate models with limited experimental data (crosslinking, HDX-MS)

    • Use molecular dynamics simulations to explore conformational dynamics

By systematically implementing these strategies while carefully documenting outcomes, researchers can significantly increase their chances of obtaining structural information about NFIA_019760, whether through crystallography or complementary methods.

How can NFIA_019760 be utilized as a tool for membrane biology studies?

NFIA_019760, as a patatin-like phospholipase, offers unique potential as a molecular tool for investigating membrane biology through several innovative applications:

Membrane Composition Analysis:

  • Site-Specific Lipid Modification:

    • Exploit NFIA_019760's specificity for certain phospholipid classes to selectively modify membrane composition

    • Use in combination with mass spectrometry for detailed lipidomic mapping

    • Compare with other phospholipases with different specificities to create a comprehensive lipid profile

  • Domain-Specific Membrane Perturbation:

    • Target NFIA_019760 to specific membrane domains using fusion to domain-specific targeting peptides

    • Monitor effects on membrane fluidity, curvature, and protein organization

    • Combine with super-resolution microscopy to visualize domain reorganization

Biosensor Development:

  • Activity-Based Probes:

    • Create fluorogenic substrates based on NFIA_019760's specificity

    • Develop FRET-based sensors for real-time monitoring of phospholipase activity

    • Engineer split-protein complementation systems for detecting protein-protein interactions

  • Membrane Stress Indicators:

    • Use altered NFIA_019760 activity as a readout for membrane perturbation

    • Create cellular reporter systems with NFIA_019760 promoter driving fluorescent protein expression

    • Develop high-throughput screening platforms for membrane-active compounds

Functional Studies:

  • Controlled Membrane Disruption:

    • Engineer inducible NFIA_019760 expression systems for temporal control of membrane modification

    • Study compensatory mechanisms in response to phospholipid hydrolysis

    • Investigate membrane repair pathways following controlled disruption

  • Protein-Lipid Interaction Studies:

    • Use catalytically inactive NFIA_019760 mutants as lipid-binding probes

    • Employ crosslinking strategies to identify protein-lipid interaction partners

    • Develop pull-down assays using immobilized NFIA_019760 to identify interacting membrane components

Methodological Considerations:
When employing NFIA_019760 for membrane biology studies, researchers should optimize enzyme concentration and activity to achieve controlled partial hydrolysis rather than complete membrane disruption. Additionally, the influence of mono- and divalent cations on enzyme activity must be carefully calibrated, as these significantly affect other N. fischeri enzymes .

For quantitative analysis, incorporate appropriate controls including heat-inactivated enzyme and catalytically inactive mutants to distinguish enzyme-specific effects from non-specific interactions .

By repurposing NFIA_019760 as a research tool, investigators can gain novel insights into membrane biology while leveraging the unique properties of this fungal phospholipase .

What approaches should be used to investigate potential biotechnological applications of NFIA_019760?

Exploring the biotechnological potential of NFIA_019760 requires systematic investigation of its unique properties and possible applications. The following research approaches are recommended:

Enzyme Engineering for Enhanced Properties:

  • Stability Enhancement:

    • Conduct directed evolution using error-prone PCR to generate variants with improved thermostability

    • Design disulfide bridges at strategic positions based on structural models

    • Screen for variants with extended half-life in industrial conditions

  • Specificity Modification:

    • Perform site-directed mutagenesis of substrate-binding pocket residues

    • Create focused libraries targeting catalytic residues and substrate recognition regions

    • Develop high-throughput screening assays for variants with altered specificity

Potential Biotechnological Applications:

  • Biocatalysis Applications:

    • Screen activity against industrially relevant substrates

    • Optimize reaction conditions for regioselective modification of complex lipids

    • Investigate compatibility with organic solvents and immobilization technologies

  • Antimicrobial Development:

    • Based on the antimicrobial properties demonstrated by other N. fischeri proteins , investigate NFIA_019760's effect on pathogenic fungi and bacteria

    • Study the mechanism of antimicrobial action through microscopy and membrane integrity assays

    • Test synergistic effects with established antimicrobials

  • Lipidomic Analysis Tools:

    • Develop NFIA_019760-based methods for selective lipid modification prior to mass spectrometry

    • Create enzyme arrays for parallel processing of lipid samples

    • Explore coupling with downstream analytical techniques

Experimental Design Considerations:
For rigorous evaluation of biotechnological potential, implement proper experimental designs as outlined in research methodology literature :

  • Comparative Testing Framework:

    • Control group: Current industry standard enzymes

    • Experimental groups: Wild-type and engineered NFIA_019760 variants

    • Multiple performance metrics (activity, stability, specificity)

  • Process Integration Assessment:

    • Scalability testing from laboratory to pilot scale

    • Compatibility with existing industrial processes

    • Economic and environmental impact analysis

Application AreaPerformance MetricsTesting Methodology
Industrial biocatalysisActivity under extreme conditionsStability assays at varied pH/temperature
Antimicrobial agentsMinimum inhibitory concentrationBroth microdilution assays
Analytical toolsSpecificity and reproducibilityLipidomic analysis of standard samples
Pharmaceutical applicationsSelectivity and side reactionsIn vitro toxicity and specificity profiling

When evaluating results, incorporate both technical performance metrics and practical considerations such as production costs, scalability, and regulatory requirements to provide a comprehensive assessment of NFIA_019760's biotechnological potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.