Recombinant Neosartorya fischeri Plasma membrane fusion protein prm1 (prm1)

Shipped with Ice Packs
In Stock

Description

Introduction to PRM1 in Neosartorya fischeri

Recombinant Neosartorya fischeri Plasma Membrane Fusion Protein PRM1 (prm1) is a genetically engineered protein derived from the filamentous fungus Neosartorya fischeri. PRM1 is a conserved multispanning membrane protein implicated in plasma membrane fusion processes, particularly during cellular mating or stress responses . Its recombinant form enables functional and structural studies in heterologous systems.

Gene Information

  • Gene Name: NFIA_105130 (annotated as prm1 in N. fischeri) .

  • Function: Encodes a plasma membrane fusion protein critical for cellular membrane dynamics.

Protein Features

  • Structure: Predicted multipass transmembrane protein with conserved domains involved in membrane interaction .

  • Molecular Weight: ~85–100 kDa (estimated based on homologous fungal PRM1 proteins) .

  • Post-Translational Modifications: Likely undergoes phosphorylation or glycosylation, common in fungal membrane proteins .

Recombinant Production and Purification

Recombinant PRM1 is produced using heterologous expression systems to ensure high yield and purity:

ParameterDetails
Expression HostE. coli, yeast, baculovirus, or mammalian cells .
TagTypically untagged or fused with His/Fc/Avi tags for purification .
Purity≥85% (verified by SDS-PAGE) .
Endotoxin Levels<1.0 EU/μg (when expressed in mammalian systems) .
StorageLyophilized or in PBS buffer with trehalose at -20°C/-80°C .

Mechanistic Studies

  • Membrane Dynamics: Used to dissect fungal mating mechanisms and membrane repair pathways .

  • Structural Biology: Purified PRM1 enables crystallization and cryo-EM studies to resolve fusion intermediates .

Biotechnological Uses

  • Drug Delivery: Engineered PRM1 variants are explored for nucleic acid delivery due to DNA-binding affinity .

  • Pathogen Research: Serves as a model to study membrane fusion in pathogenic fungi (e.g., Coccidioides immitis) .

Key Findings

  • Defective Fusion in Mutants: Loss of PRM1 homologs leads to membrane lysis and impaired cell fusion .

  • Interactome: PRM1 interacts with calcium-binding proteins (e.g., Tcb3) to mitigate fusion-associated damage .

Open Questions

  • Structural Resolution: Full-length PRM1’s 3D structure remains unresolved.

  • Species-Specific Roles: Functional divergence between N. fischeri PRM1 and homologs in other fungi is poorly understood .

Table 1: Recombinant PRM1 Across Species

SpeciesExpression HostTagPurityKey Application
Neosartorya fischeri E. coliUntagged/His≥85%Membrane fusion studies
Coccidioides immitis E. coliHis>90%Pathogen membrane biology
Rattus norvegicus HEK293His-Fc-Avi≥85%Chromatin compaction studies

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage condition, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
prm1; NFIA_105130; Plasma membrane fusion protein prm1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-742
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
prm1
Target Protein Sequence
MLFSRSGRSIFPLLPPYAAHAPNPNQGHIITLPPDGLTPYLGLRARLSQVWINRWTILLL LVLVRVLLAASGLQADMSTAKREALSACTSVESMGSSMASMPHYLSQGVNELTASGVEKA VSGLKSMLMLTITGVEELVLFIIKVLYQTYLCLFTLAVRGSVHVAVGVIEEAADFLNSTV KEVGDDIGKAVSTFESAFNKFLDGVNTVASAFGASVPTLDLNSSISALENLQLPSSIDKG LDKLNSSLPTFDEVNNFTQTVLRTPFEEVKKLVNESLGTYTFDRSLLPVPAKEQLTFCEG NNGIDSFFDSVTDLVMTARKIFIAVLIVAATLACVPMAWQEIRRWRSMKERSQLVRKEAH DPMDVVYIVSRPYTAAAGIKAASRFSNSRRQILVRWAVAYATTPAALFVLCLGVAGLLSC LCQYLLLQAVEKTVPELSTQVGAFADKVVDSLQNASAEWANDANGVIGHMNQDLNENVFG WVNTSTTALNDTLNTFVDKTTGVLNDTFGGTLLYEPLMDVFECLIGLKVQGIQKGLTWVH DHAHIDFPLLPNDTFSRGAAASISSNSSNPSDSFLADAGDQTSNKITEVVIRVVNKVEDG VRTETIISAVIILIWVFIALVGIVRALSLFWVRDRNRGEGGGARVNRHESDAGGFIDVPL TAIPNTNTDARSMPTPAPAPAPRYEASTSTVVASRAVPVSSTHHEDEKLGFAGERQYGSA LKVDGAADLRGSSYVEYDMEKR
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell fusion during mating by stabilizing the plasma membrane fusion event.
Database Links
Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fischeri β-glucosidase and what are its primary characteristics?

Neosartorya fischeri β-glucosidase (NfBGL1) is a thermophilic enzyme belonging to glycoside hydrolase family 3. The mature protein consists of 722 amino acids (after removal of a 17-residue signal peptide) with a molecular mass of approximately 78.8 kDa and a pI value of 5.54 . NfBGL1 is characterized by its remarkably high specific activity against p-nitrophenyl β-D-glucopyranoside (pNPG), reaching 2189±1.7 U/mg, significantly higher than other fungal β-glucosidases . It demonstrates optimal activity at 80°C and maintains stability at temperatures up to 70°C across a broad pH range of 3.0-10.0 . The enzyme exhibits broad substrate specificity with glucosidase, cellobiase, xylanase, and glucanase activities, showing particular preference for hydrolyzing β-1,2 glycosidic bonds over β-1,3, β-1,4, and β-1,6 bonds .

What is the plasma membrane fusion protein prm1 and what is its role in cell fusion?

Prm1 is a multipass membrane protein that plays a critical role in the membrane fusion step during yeast mating. It localizes to the cell surface at the fusion zone in mating pairs . When PRM1 is deleted, approximately 40% of mating pairs arrest as unfused prezygotes with closely apposed but unfused plasma membranes, often exhibiting characteristic cytoplasmic bubbles where the plasma membranes are pushed into one of the cells at the contact zone . Additionally, about 20% of prm1Δ × prm1Δ mating pairs undergo contact-dependent lysis, which is distinct from Pkc1-regulated lysis and cannot be suppressed by osmotic support . These observations suggest that Prm1 is an integral component of the membrane fusion machinery, helping to maintain the fidelity of the fusion process and prevent aberrant outcomes such as membrane lysis.

How are these proteins typically expressed and purified for research purposes?

For NfBGL1:
The gene is typically cloned from Neosartorya fischeri P1 using specific primers designed based on genome sequence information. For high-yield expression, the Pichia pastoris expression system has proven effective, with the gene being inserted into vectors such as pPIC9 . Expression is induced with methanol, and significant yield improvements (up to 56-fold) can be achieved using high-cell-density fermentation in a controlled bioreactor compared to shake flask cultures . The recombinant protein contains no N-glycosylation despite having two putative N-glycosylation sites (Asn207 and Asn381) .

For Prm1:
Expression studies typically involve genetic manipulation in yeast systems, often using mating type experiments to assess functionality. Specific purification protocols for recombinant Prm1 are not detailed in the provided search results.

How does the molecular structure of NfBGL1 contribute to its thermostability and high specific activity?

When investigating structure-function relationships, researchers should consider:

  • The presence of stabilizing salt bridges and disulfide bonds

  • Amino acid composition favoring thermostability (e.g., increased proportion of charged residues)

  • Structural elements that optimize substrate binding and catalysis

  • The role of N-glycosylation sites (though not glycosylated in the recombinant form)

Further research using site-directed mutagenesis could help identify specific residues critical for thermostability and catalytic efficiency.

What is the relationship between membrane fusion defects and calcium signaling in prm1 mutants?

Research indicates a complex relationship between Prm1, the calcium-influx controlling protein Fig1, and calcium signaling during membrane fusion in yeast mating. While extracellular calcium is not required for efficient cell fusion in wild-type cells, deletion of FIG1 results in cell fusion defects similar to those observed in prm1 mutants . Furthermore, cell fusion in prm1 mutant mating pairs is dramatically reduced when calcium is removed from the medium, with enhanced fusion defects primarily attributable to increased lysis events .

Time-lapse microscopy reveals that fusion and lysis events initiate with identical kinetics, suggesting both outcomes result from engagement of the fusion machinery . The yeast synaptotagmin orthologue Tcb3, a calcium-binding protein, plays a role in reducing lysis of prm1 mutants . These findings suggest a model where:

  • Prm1 and Fig1 enhance membrane fusion fidelity

  • Their absence leads to fusion defects and membrane lysis

  • Calcium-dependent mechanisms (potentially involving Tcb3) counteract membrane damage through repair processes

Researchers investigating this relationship should design experiments that manipulate calcium levels while monitoring both fusion efficiency and lysis frequency, potentially using fluorescent markers to visualize these events in real-time.

What are the hypothesized molecular mechanisms behind prm1's role in preventing membrane lysis during fusion?

Based on the research findings, several hypotheses can explain prm1's role in preventing membrane lysis:

  • Fusion Pore Stabilization: Prm1 may stabilize nascent fusion pores, as evidenced by the observation that fusion pores in Δprm1 × Δprm1 mating pairs show decreased initial permeance . Without Prm1, these unstable fusion intermediates might rupture rather than expand.

  • Fusogen Coordination: Prm1 could coordinate the activity of other fusion machinery components, ensuring their synchronized action during the fusion process. Its absence might lead to uncoordinated or incomplete fusion attempts that result in membrane damage.

  • Membrane Tension Regulation: During the fusion process, local membrane curvature and tension change dramatically. Prm1 might help regulate these physical parameters, preventing excessive tension that could lead to membrane rupture.

  • Protection from Fusion Byproducts: The fusion process might generate potentially damaging byproducts (e.g., lipid intermediates); Prm1 could protect membranes from these effects.

The observation that lysis is contact-dependent and cannot be suppressed by osmotic support strongly suggests that lysis occurs as a direct consequence of engaging a defective fusion machinery rather than general membrane weakness .

What expression systems are most effective for producing recombinant NfBGL1?

The Pichia pastoris expression system has proven highly effective for recombinant NfBGL1 production. Key methodological considerations include:

  • Vector Selection: The pPIC9 vector system has been successfully employed for NfBGL1 expression .

  • Fermentation Strategy: High-cell-density fermentation in a 3.7-l fermentor significantly increases yield compared to shake flask cultures. After methanol induction, β-glucosidase activity in the supernatant reached a maximum of 1873±1.5 U/ml at 159 h, representing a 56-fold increase over shake flask cultures .

  • Induction Protocol: No β-glucosidase activity is detected before the induction phase, indicating tight regulation of expression. Methanol induction triggers the accumulation of the recombinant enzyme in the culture supernatant .

  • Purification Approach: The secreted nature of the enzyme facilitates downstream processing, although specific purification protocols should be optimized based on experimental requirements.

The significant activity increase in bioreactor conditions is attributed to higher dissolved oxygen levels and more efficient mass transfer in the aerated system compared to shake flasks .

How can researchers accurately measure and compare the hydrolytic efficiency of NfBGL1 against various substrates?

To accurately measure and compare the hydrolytic efficiency of NfBGL1 against various substrates, researchers should consider the following methodological approaches:

  • Standard Activity Assays: For basic activity measurements, using p-nitrophenyl β-D-glucopyranoside (pNPG) as a substrate allows for colorimetric detection of released p-nitrophenol, providing a standardized measure of specific activity (U/mg) .

  • Substrate Panel Testing: To characterize substrate specificity, researchers should test NfBGL1 against diverse substrates with different glycosidic bonds (β-1,2, β-1,3, β-1,4, β-1,6) and structural features.

  • Kinetic Parameter Determination: Calculate Km, Vmax, kcat, and kcat/Km values for each substrate to quantitatively compare enzyme-substrate affinity and catalytic efficiency.

  • HPLC Analysis: For specific applications such as isoflavone glycoside hydrolysis, HPLC analysis provides quantitative measurement of substrate conversion and product formation. The method involves:

    • Incubating the enzyme with substrate under controlled conditions

    • Stopping the reaction (e.g., by boiling)

    • Analyzing supernatants using HPLC with a C18 column

    • Using acetonitrile and phosphate buffer (70:30 v/v) as the mobile phase

    • Detecting products at 260 nm

  • Temperature and pH Optimization: All assays should be conducted under optimal conditions (80°C and appropriate pH) to ensure maximum activity and accurate comparisons .

What experimental approaches can effectively study the interactions between Prm1 and Fig1 during membrane fusion?

To effectively study interactions between Prm1 and Fig1 during membrane fusion, researchers can employ the following experimental approaches:

  • Genetic Analysis:

    • Create single and double knockout strains (prm1Δ, fig1Δ, prm1Δ fig1Δ)

    • Conduct quantitative mating assays to measure fusion efficiency

    • Compare fusion defect phenotypes (prezygote accumulation, bubble formation, lysis events)

  • Live-Cell Imaging:

    • Use time-lapse microscopy to track fusion and lysis events in real-time

    • Apply fluorescent protein tagging to visualize protein localization during fusion

    • Implement membrane-specific dyes to observe membrane dynamics

  • Calcium Dependency Studies:

    • Manipulate extracellular calcium concentrations during mating

    • Use calcium indicators to monitor calcium flux during fusion attempts

    • Compare wild-type and mutant responses to calcium perturbation

  • Biochemical Interaction Analysis:

    • Perform co-immunoprecipitation to detect physical interactions

    • Use proximity labeling techniques to identify proteins in close association

    • Apply FRET/BRET to detect protein-protein interactions in living cells

  • Structural Studies:

    • Conduct site-directed mutagenesis to identify critical interaction domains

    • Use crosslinking approaches to capture transient interactions

    • Apply electron microscopy to visualize fusion intermediates

  • Electrophysiological Measurements:

    • Measure fusion pore formation and expansion kinetics

    • Compare initial permeance of fusion pores in different genetic backgrounds

How can researchers reconcile the observed high thermostability of NfBGL1 with its application in biological systems that operate at much lower temperatures?

The reconciliation of NfBGL1's high thermostability (optimal temperature of 80°C) with applications in mesophilic biological systems requires careful consideration of several factors:

  • Activity Profile Across Temperature Range: While NfBGL1 shows optimal activity at 80°C, it likely retains significant activity at lower temperatures. Researchers should generate complete temperature-activity profiles to determine efficiency at physiologically relevant temperatures.

  • Stability Advantages: The thermostability of NfBGL1 provides several practical advantages even when used at lower temperatures:

    • Extended shelf-life and operational stability

    • Resistance to denaturation during purification and handling

    • Tolerance to previously inhibitory processing conditions

    • Potentially increased resistance to proteolytic degradation

  • Reaction Rate Considerations: Even if operating below its optimal temperature, NfBGL1's inherently high specific activity (2189±1.7 U/mg) may still exceed that of mesophilic enzymes at their optimal temperatures .

  • Application-Specific Benefits: For applications like isoflavone glycoside hydrolysis, the ability to perform reactions at elevated temperatures (even if not at 80°C) may offer advantages such as:

    • Increased substrate solubility

    • Reduced risk of microbial contamination

    • Altered viscosity of reaction media

    • Potentially favorable shifts in reaction equilibria

  • Enzyme Engineering Potential: If necessary, protein engineering approaches could modify the temperature profile while retaining the favorable structural features that contribute to its high specific activity.

What are the potential explanations for differential outcomes (fusion versus lysis) in prm1 mutant mating pairs?

The observation that prm1Δ × prm1Δ mating pairs exhibit both fusion defects (40% unfused pairs) and lysis events (20% of pairs) presents an interesting contradiction that requires careful interpretation . Several potential explanations can reconcile these differential outcomes:

  • Stochastic Fusion Machine Engagement: The engagement of the fusion machinery might be probabilistic, with random variations in the local concentrations of fusion factors determining whether a productive fusion event or lysis occurs.

  • Compensatory Mechanisms: Alternative fusion pathways or compensatory mechanisms might successfully mediate fusion in some mating pairs but not others. The efficiency of these backup systems could vary between individual cells.

  • Temporal Factors: The timing of fusion machine engagement relative to other cellular processes (e.g., cell wall degradation, calcium influx) might influence outcomes. Time-lapse microscopy showing identical initiation kinetics for both fusion and lysis supports this view .

  • Membrane Composition Variability: Differences in local membrane composition (lipids, proteins) between individual cells could affect fusion outcomes. Some membrane compositions might be more prone to lysis when Prm1 is absent.

  • Calcium-Dependent Repair: The calcium-dependent membrane repair mechanism involving Tcb3 might successfully rescue some lysis events while failing in others . Local variations in calcium concentration or Tcb3 availability could explain this differential success.

  • Environmental Microheterogeneity: Small variations in the local microenvironment of individual mating pairs could influence fusion outcomes, particularly if prm1 mutants are more sensitive to such variations than wild-type cells.

Understanding these differential outcomes requires methodologies that can track individual mating pairs over time while simultaneously monitoring multiple parameters (e.g., membrane integrity, calcium flux, protein localization).

What are promising approaches for engineering NfBGL1 to enhance its catalytic efficiency or substrate specificity?

Several promising approaches for engineering NfBGL1 to enhance its properties include:

  • Structure-Guided Mutagenesis:

    • Target residues in the active site to modify substrate specificity

    • Modify substrate binding pocket to accommodate different glycosidic linkages

    • Engineer surface residues to enhance stability while maintaining flexibility

  • Directed Evolution:

    • Develop high-throughput screening assays for desired properties

    • Apply error-prone PCR or DNA shuffling to generate variant libraries

    • Screen for variants with improved activity at lower temperatures or altered specificity

  • Domain Swapping:

    • Identify and swap functional domains with other glycoside hydrolases

    • Create chimeric enzymes with novel combinations of substrate recognition and catalytic domains

  • Computational Design Approaches:

    • Use molecular dynamics simulations to identify stabilizing mutations

    • Apply computational enzyme design to predict mutations that might enhance catalytic efficiency

    • Model enzyme-substrate interactions to guide rational design efforts

  • Immobilization Strategies:

    • Develop novel immobilization techniques to enhance stability and reusability

    • Explore different immobilization matrices compatible with various reaction conditions

    • Optimize enzyme orientation during immobilization to maximize substrate accessibility

These engineering efforts could expand NfBGL1's utility in various applications, including more efficient isoflavone glycoside hydrolysis, production of bioactive compounds, and potential use in biofuel production .

What research gaps need to be addressed to better understand the coordinated function of Prm1 and Fig1 in membrane fusion?

Several critical research gaps need addressing to better understand the coordinated function of Prm1 and Fig1 in membrane fusion:

  • Structural Characterization:

    • Determine the three-dimensional structures of Prm1 and Fig1

    • Identify potential interaction domains between these proteins

    • Characterize conformational changes during the fusion process

  • Direct Interaction Studies:

    • Establish whether Prm1 and Fig1 physically interact or function in parallel pathways

    • Identify additional components of the fusion complex

    • Determine the stoichiometry of the fusion machinery components

  • Calcium Signaling Mechanisms:

    • Elucidate the precise role of calcium in promoting fusion versus preventing lysis

    • Identify calcium sensors that mediate these effects

    • Characterize the temporal and spatial dynamics of calcium flux during fusion

  • Fusion Intermediate Characterization:

    • Develop methods to capture and analyze fusion intermediates

    • Determine the architecture of the fusion pore

    • Understand the transitions between hemifusion and complete fusion states

  • Comparative Studies:

    • Investigate whether similar mechanisms operate in other cell-cell fusion contexts

    • Compare yeast fusion machinery with viral and mammalian cell fusion systems

    • Identify evolutionarily conserved principles governing membrane fusion

  • Integration with Cell Wall Remodeling:

    • Clarify how cell wall degradation coordinates with membrane fusion

    • Understand how signals transmit from cell wall to plasma membrane

    • Explore the relationship between Fus1 (involved in cell wall removal) and the Prm1-Fig1 system

Addressing these gaps would significantly advance our understanding of fundamental cellular processes and potentially inform therapeutic strategies for diseases involving membrane fusion defects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.