Recombinant Neosartorya fischeri Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; NFIA_109810; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)
Target Names
get1
Target Protein Sequence
MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSKNAREQSRLKREVVQLKR EMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKIARWLSTNGLKIF LQFYYSKTPVFALPAGWFPSYVEWVLSFPRAPRGSVSVQVWNSVCATAIAVMAEIVTSML LQLRSRSASPASTAKAQKAQ
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble Get3, which specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol.
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fischeri and what notable recombinant proteins have been isolated from it?

Neosartorya fischeri (also referred to as Aspergillus fischeri in some contexts) is a thermophilic filamentous fungus belonging to the Ascomycetes. Two significant proteins have been successfully produced as recombinant proteins:

  • NFAP (Neosartorya fischeri antifungal protein): A small, cysteine-rich, highly stable antifungal protein that effectively inhibits numerous filamentous Ascomycetes including potential human and plant pathogens .

  • NfBGL1: A thermophilic β-glucosidase belonging to glycoside hydrolase family 3, capable of efficiently converting isoflavone glycosides into free isoflavones with potential biotechnological applications .

Both proteins have been successfully expressed in heterologous systems, particularly Pichia pastoris, to produce functionally active recombinant forms.

What is the GET pathway and what role does GET1 play in it?

The GET (Guided Entry of Tail-anchored proteins) pathway is essential for the insertion of tail-anchored (TA) membrane proteins into the endoplasmic reticulum (ER). TA proteins are characterized by a single transmembrane domain at their C-terminus .

GET1 functions as a transmembrane receptor in the ER membrane, forming a complex with another receptor protein (GET2 in yeast or CAML in mammals). This receptor complex serves as the membrane insertion machinery for TA proteins . The GET1/GET2 receptor complex interacts with GET3 (the cytosolic targeting factor bound to TA proteins) to facilitate the insertion of TA proteins into the ER membrane .

What is the structure and mechanism of NFAP (Neosartorya fischeri antifungal protein)?

NFAP is a small, cysteine-rich antifungal protein with the following structural and functional characteristics:

Structure:

  • Solution structure revealed by PDB entry 5OQS shows a compact fold stabilized by disulfide bridges formed between conserved cysteine residues

  • Exhibits a highly cationic character contributing to its antifungal activity

  • Shows structural similarity to other fungal antifungal proteins despite low sequence homology

Mechanism of action:

  • Interferes with cell wall organization and destroys chitin filaments

  • Induces apoptotic/necrotic events through reactive oxygen species accumulation

  • Activates the cAMP/protein kinase A pathway via G-protein signaling, leading to apoptosis and inhibition of polar growth

  • Does not show direct membrane disruption or uptake by endocytosis, distinguishing it from some related antifungal proteins

  • Within a short exposure time, causes reduced cellular metabolism, apoptosis induction, and changes in actin distribution and chitin deposition at the hyphal tip in sensitive fungi like Aspergillus nidulans

The antifungal mechanism of NFAP involves both similarities and differences compared to related proteins from Aspergillus giganteus and Penicillium chrysogenum, providing insights into the diversity of antifungal mechanisms in this protein family .

What expression systems are optimal for producing recombinant NFAP?

The optimal expression of recombinant NFAP requires careful selection of expression systems and conditions:

Preferred expression system:

  • Pichia pastoris has been successfully used for NFAP expression, producing the protein in an antifungally active and correctly folded state

  • This methylotrophic yeast system is advantageous because:

    • It performs proper disulfide bond formation essential for NFAP activity

    • It provides a eukaryotic expression environment with appropriate post-translational modifications

    • It secretes the protein into the medium, facilitating purification

Optimization strategies:

  • Using strong inducible promoters (e.g., AOX1 in P. pastoris)

  • Including appropriate secretion signals

  • Optimizing codon usage for the host organism

  • Controlling culture conditions (pH, temperature, induction timing)

Heterologous expression in P. pastoris has been demonstrated to produce NFAP with antifungal activity comparable to the native protein, making this an effective system for obtaining sufficient quantities for structural and functional studies .

How can we design functional complementation assays for GET pathway components?

Functional complementation assays provide powerful tools for studying GET pathway components across species:

Yeast-based complementation system:

  • Generate yeast strains with deletions in GET pathway components (e.g., Δget1get2 double mutants)

  • Create expression vectors containing GET pathway components from different species

  • Transform these vectors into deletion strains

  • Assess growth under normal and stress conditions (particularly elevated temperatures) to determine functional complementation

Example complementation data:

Expression combinationRescue of Δget1get2 growth at elevated temperatureNotes
AtGET1 + G1IPWeak rescueArabidopsis proteins show some functional conservation
AtGET1 + G1IP-likeNo rescueG1IP-like likely has a different function
ScGET1 + ScGET2Strong rescueHomologous combination works best
AtGET1 + ScGET2Moderate rescueCross-species mixing shows partial compatibility
ScGET1 + G1IPVery weak rescueLeast effective heterologous combination

What techniques are most effective for characterizing recombinant NfBGL1?

Comprehensive characterization of recombinant NfBGL1 requires multiple analytical approaches:

Expression and purification:

  • High-density fermentation in Pichia pastoris (3.7-L fermentor scale has been reported successful)

  • Purification using appropriate chromatographic techniques

Enzymatic characterization:

  • Specific activity determination using standard substrates (e.g., p-nitrophenyl β-D-glucopyranoside)

  • Temperature optimum and stability profiling (particularly relevant for this thermophilic enzyme)

  • pH stability assessment across a broad range

  • Substrate specificity analysis across different glycosidic linkages

Key properties of recombinant NfBGL1:

PropertyValueComparison to other fungal β-glucosidases
Specific activity2189 ± 1.7 U/mgHigher than most fungal counterparts
Temperature optimum80°CSignificantly higher than typical fungal enzymes
Thermal stabilityUp to 70°CExcellent thermostability
pH stability3.0-10.0Exceptionally broad range
Preferred glycosidic bondβ-1,2Distinctive preference compared to most β-glucosidases

For application-specific characterization, HPLC analysis of isoflavone glycoside conversion to aglycones (free isoflavones) is essential to verify the enzyme's biotechnological potential .

What molecular interactions govern GET1 function in the GET receptor complex?

The GET1 protein functions within a heteromeric receptor complex, with several key molecular interactions determining its functionality:

Interaction with GET2/CAML:

  • The transmembrane domains (TMDs) of GET1 interact with the TMDs of its partner protein

  • This interaction is essential for forming a functional receptor complex

  • Although sequence conservation between GET2 and CAML is poor across kingdoms, the structural topology is conserved, typically featuring three TMDs

Domain-specific interactions:
When investigating Arabidopsis G1IP (GET1-interacting protein), researchers found:

  • G1IP acts as a binding partner of AtGET1 primarily via its transmembrane domains

  • The cytosolic region of G1IP showed almost complete absence of interaction signal in BiFC assays

  • Both co-immunoprecipitation and BiFC confirmed that the TMDs, not the cytosolic tail, mediate the interaction

Evolutionary considerations:

  • Despite low sequence conservation, the GET receptor complex shows striking structural similarities across kingdoms

  • All identified homologs maintain similar topology (cytosolic N-terminus, luminal C-terminus)

  • A positively charged N-terminus (at least four arginine or lysine residues in a row) appears to be a conserved feature

Understanding these molecular interactions provides crucial insights into the mechanism of TA protein insertion and the evolutionary conservation of this essential cellular machinery.

How does NFAP's mechanism of action compare to other antifungal proteins?

NFAP shows both similarities and differences compared to related antifungal proteins:

Key experimental findings on NFAP mechanism:

  • NFAP activates the cAMP/protein kinase A pathway via G-protein signaling

  • This activation leads to apoptosis and inhibition of polar growth in sensitive fungi

  • NFAP does not have a direct membrane-disrupting effect, unlike some other antifungal proteins

  • NFAP is not taken up by endocytosis, suggesting a different interaction with target cells

Comparative analysis with mutant fungal strains:

StrainGrowth at 200 µg/mL NFAPGrowth at 100 µg/mL NFAPGrowth at 50 µg/mL NFAPInterpretation
∆mpkA108% ± 9.1%***105% ± 6.7%***103% ± 0.9%**NFAP does not act through cell wall integrity pathway
∆pkaA56% ± 6.1%***69% ± 5.3%***83% ± 11.5%**Protein kinase A involved in NFAP sensitivity
RhoA G14V48% ± 15.2% ns57% ± 4.5% ns86% ± 12.5% nsG-protein signaling may be involved
alcA-PkcADifferent responses depending on promoter conditionsComplex involvement of protein kinase C

This table shows that deletion of the mitogen-activated protein kinase (mpkA) renders fungi resistant to NFAP, while protein kinase A pathway mutants show altered sensitivity . These findings distinguish NFAP from some related proteins and provide insights into its unique mechanism of action.

What factors contribute to the thermostability of NfBGL1?

NfBGL1 exhibits remarkable thermostability with activity at temperatures up to 70°C and an optimal temperature of 80°C . Several structural and biochemical factors likely contribute to this unusual thermostability:

Structural features:

  • The enzyme belongs to glycoside hydrolase family 3

  • The protein consists of 739 amino acids with a putative signal peptide of 17 residues

  • Two putative N-glycosylation sites (Asn207 and Asn381) have been identified

  • The estimated molecular mass is 78.8 kDa with a pI value of 5.54

Thermostability characteristics:

  • Maintains stability at temperatures up to 70°C

  • Functions effectively over an extremely broad pH range (3.0-10.0)

  • Displays multi-functionality with glucosidase, cellobiase, xylanase and glucanase activities

Understanding these thermostability factors is essential for potential protein engineering efforts and industrial applications requiring high-temperature processes, such as bioethanol production or food processing.

How can recombinant NFAP be applied in antifungal research and development?

Recombinant NFAP offers several promising applications in antifungal research:

Potential applications:

  • Development of novel antifungal agents for medical use, especially against drug-resistant fungi

  • Agricultural applications to combat plant pathogenic fungi

  • Protective treatments for cultural heritage materials against fungal deterioration

  • Research tool for studying fungal cell signaling pathways

Advantages of NFAP:

  • Small size and stability make it amenable to production and formulation

  • Specific antifungal activity against filamentous Ascomycetes including potential human and plant pathogens

  • Novel mechanism of action different from conventional antifungals

  • Successful heterologous expression system established

What insights does the GET pathway provide for membrane protein biogenesis research?

The GET pathway research offers valuable insights into fundamental aspects of membrane protein biogenesis:

Research implications:

  • Provides a model system for studying co-translational vs. post-translational membrane insertion mechanisms

  • Illuminates how cells handle the challenging biophysics of membrane protein insertion

  • Demonstrates conservation of functional mechanisms despite low sequence conservation

  • Reveals the importance of transmembrane domain interactions in multiprotein complexes

Evolutionary insights:

  • The GET receptor complex shows low sequence conservation but maintains structural similarities across species

  • The N-terminal Get3 interaction motif and C-terminal membrane anchoring domain co-evolve across species

  • Different organisms have evolved specialized versions of the pathway while maintaining the core machinery

  • Study of plant GET pathway components like AtGET1 and G1IP provides unique perspective on evolutionary adaptations

These findings contribute to our understanding of cellular protein trafficking mechanisms and may inform future research on membrane protein folding diseases, protein engineering, and synthetic biology applications.

How can genomic approaches be used to identify novel thermostable enzymes similar to NfBGL1?

Mining fungal genomes for novel thermostable enzymes requires sophisticated genomic approaches:

Identification strategies:

  • Genome mining within thermophilic fungal species to identify orthologous genes

  • Screening of environmental samples from high-temperature habitats

  • Bioinformatic analysis of protein sequences for features associated with thermostability

  • Structural prediction using known thermostable proteins as templates

Case study of NfBGL1:

  • The NfBGL1 gene was identified based on the genome sequence of a hypothetical β-glucosidase from N. fischeri NRRL 181 (XP_001261562)

  • Specific primers were designed based on this sequence to amplify the gene from N. fischeri P1

  • The gene was then successfully expressed in Pichia pastoris, resulting in a highly active thermostable enzyme

This approach can be expanded to identify other thermostable enzymes from Neosartorya species and related thermophilic fungi, potentially yielding new biocatalysts for industrial applications in food processing, biofuel production, and pharmaceutical manufacturing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.