Recombinant Neosartorya fischeri Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

What is Neosartorya fischeri Vacuolar ATPase assembly integral membrane protein VMA21 and how is it structurally characterized?

VMA21 is an essential assembly factor for the vacuolar H+-ATP complex (V-ATPase), a multisubunit protein complex required for acidification of intracellular compartments. In Neosartorya fischeri (strain ATCC 1020/DSM 3700/FGSC A1164/NRRL 181), also known as Aspergillus fischerianus, VMA21 is a 107-amino acid protein characterized by:

• A UniProt ID of A1D7K7

• Gene name: vma21 (ORF name: NFIA_068710)

• Amino acid sequence: MTSRRSQEKSYAEAAAAPPPKEAASSDVTPAVPADVIYKLLGFTAAMVVGPIGMYFITVNSGASSTVAGITAAITANLVLFGYIYVAWLDDREEREAASKKKEKKAQ

The protein contains transmembrane domains that anchor it in the endoplasmic reticulum (ER) membrane, where it functions in the assembly of the V-ATPase complex. Structural analysis indicates it contains hydrophobic regions consistent with its role as an integral membrane protein.

How does VMA21 function in the V-ATPase assembly pathway?

VMA21 serves as a critical assembly factor for the V-ATPase complex, particularly in the assembly of the V₀ subcomplex in the endoplasmic reticulum. Research indicates that:

• VMA21 interacts directly with V₀ subunits during their assembly in the ER

• It forms part of a larger assembly factor complex including other proteins such as ATP6AP2

• Deficiency in VMA21 leads to reduced V₀ subunit expression and impaired V-ATPase assembly

The functional mechanism involves:

When VMA21 function is compromised, the consequences include reduced lysosomal acidification and impaired degradation of phagocytosed materials, which can lead to accumulation of lipid droplets in autolysosomes .

What expression systems are most effective for producing recombinant Neosartorya fischeri VMA21?

Based on current research protocols, the following expression systems have been documented for recombinant N. fischeri VMA21:

The available literature indicates successful expression in E. coli with an N-terminal His-tag for the full-length protein (amino acids 1-107) . This approach provides sufficient protein for most analytical applications while maintaining the structural integrity necessary for functional studies.

What purification and storage protocols ensure optimal stability of recombinant VMA21?

For membrane proteins like VMA21, optimized purification and storage conditions are crucial for maintaining structural and functional integrity:

Recommended Purification Protocol:

• Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

• Buffer optimization containing mild detergents to maintain membrane protein solubility

• Size exclusion chromatography for final polishing and buffer exchange

Storage Recommendations:

• Store in Tris/PBS-based buffer with 6% trehalose, pH 8.0

• For lyophilized protein, reconstitute to 0.1-1.0 mg/mL in deionized sterile water

• Add glycerol to 50% final concentration for long-term storage

• Aliquot to avoid repeated freeze-thaw cycles

• Store at -20°C/-80°C for extended storage

• Working aliquots can be maintained at 4°C for up to one week

The literature emphasizes avoiding repeated freeze-thaw cycles as this significantly impairs protein stability and function. The addition of trehalose (6%) in storage buffers serves as a protein stabilizer during freezing and thawing processes .

How can researchers accurately identify Neosartorya fischeri to avoid misidentification with Aspergillus fumigatus?

Misidentification between Neosartorya fischeri and Aspergillus fumigatus is common in laboratory settings due to morphological similarities. Researchers should implement the following identification approach:

Morphological Identification (Limited Reliability):

• N. fischeri typically produces white or greenish-gray fluffy colonies with white edges on Czapek Dox agar (CZA) and inhibitory mold agar (IMA) after 2-3 days of growth

• Microscopic examination with lactophenol aniline blue can reveal characteristic structures, but these are often insufficient for definitive identification

Molecular Identification (Recommended):

• DNA extraction from pure culture

• PCR amplification of the internal transcribed spacer (ITS) regions and/or β-tubulin gene

• DNA sequencing of the amplified regions

• Sequence comparison against reference databases

This molecular approach is essential as the study by Cawcutt et al. demonstrated that reliance on morphological identification alone led to misidentification of N. pseudofischeri as A. fumigatus, which could have significant implications for treatment decisions in clinical settings and accuracy in research .

What are the key homologies and differences between VMA21 in Neosartorya fischeri and human VMA21?

Understanding the evolutionary relationship between fungal and human VMA21 provides valuable insights for comparative biology and potential therapeutic applications:

The functional conservation between species highlights the evolutionary importance of this protein in cellular homeostasis. Human VMA21 mutations result in distinct clinical phenotypes depending on the mutation type and location, with some affecting primarily muscle tissue (XMEA) and others causing liver dysfunction with glycosylation abnormalities (CDG) .

How can researchers utilize VMA21 models to investigate lysosomal acidification and autophagy mechanisms?

VMA21 provides an excellent model system for studying fundamental cellular processes related to lysosomal function and autophagy:

Experimental Approaches:

• Cell-based models:

  • VMA21 knockdown/knockout in appropriate cell lines

  • Rescue experiments with wild-type and mutant VMA21

  • Assessment of lysosomal pH using fluorescent probes

  • Quantification of autophagic flux using LC3-II/LC3-I ratios

• Subcellular fractionation studies:

  • Isolation of lysosomes to assess V-ATPase assembly

  • Analysis of lysosomal enzymatic activity under different pH conditions

  • Proteomics analysis of lysosomal protein composition in VMA21-deficient cells

• Lipophagy assessment:

  • Oil Red O or BODIPY staining to visualize lipid droplets

  • Electron microscopy to identify autolysosomes containing lipid droplets

  • Co-localization studies between autophagic markers and lipid droplets

Research has demonstrated that VMA21 deficiency leads to impaired lysosomal acidification, resulting in defective lipophagy and accumulation of lipid droplets in autolysosomes. These findings have broader implications for understanding common conditions like non-alcoholic fatty liver disease (NAFLD) .

What insights do VMA21 mutations provide regarding the relationship between V-ATPase assembly and congenital disorders of glycosylation?

The connection between VMA21 function and glycosylation disorders offers significant research opportunities:

VMA21 deficiency has been identified as causing a congenital disorder of glycosylation (CDG) characterized by:

• Chronic elevation of aminotransferases

• Hypercholesterolemia with increased LDL cholesterol

• Hepatic steatosis

• Abnormal glycosylation patterns detectable in serum

Glycosylation Analysis Methods:

• Transferrin isoelectric focusing (TIEF)

• Apolipoprotein CIII isoelectric focusing (apoCIII-IEF)

• High-resolution QTOF mass spectrometry analysis of transferrin

• MALDI-TOF analysis of total plasma-derived N-glycans

These analyses reveal characteristic patterns in VMA21-CDG patients, including:

• Combined N-glycosylation and O-glycosylation abnormalities

• Truncated glycans lacking galactose and sialic acid

Interestingly, while VMA21 mutations causing XMEA (myopathy) do not show detectable glycosylation abnormalities, both patient groups demonstrate elevated LDL cholesterol, suggesting overlapping pathophysiological mechanisms with different tissue specificities .

How can researchers design experiments to elucidate VMA21's role in ER stress response and lipid metabolism?

VMA21 deficiency triggers ER stress and affects cholesterol metabolism, providing a valuable model for studying these interconnected pathways:

Recommended Experimental Design:

• ER stress evaluation:

  • Analysis of PERK phosphorylation status

  • Expression profiling of ER stress markers (BiP, CHOP, XBP1 splicing)

  • Ultrastructural analysis of ER morphology by electron microscopy

• Cholesterol metabolism assessment:

  • Analysis of sterol response element-binding protein (SREBP) activation

  • Measurement of cholesterol synthesis rates using labeled precursors

  • Visualization of unesterified cholesterol distribution using filipin staining

  • Quantification of LDL receptor expression and activity

• Integrated multi-omics approach:

  • Transcriptomics to identify gene expression changes in response to VMA21 deficiency

  • Lipidomics to characterize alterations in lipid species

  • Proteomics to detect changes in protein abundance and post-translational modifications

Research has demonstrated that VMA21 deficiency leads to sequestration of unesterified cholesterol in lysosomes, which activates SREBP-mediated cholesterol synthesis pathways. This mechanism explains the elevated LDL cholesterol observed in affected patients and provides insights into potential therapeutic targets for both rare VMA21-related disorders and more common conditions like NAFLD .

How might understanding N. fischeri VMA21 contribute to broader research on fungal pathogenesis and drug development?

The study of VMA21 in Neosartorya fischeri has significant implications for understanding fungal biology and developing antifungal strategies:

• Fungal identification and pathogenesis:

  • Accurate molecular identification of Neosartorya species is crucial as they are often misidentified as Aspergillus fumigatus using morphological criteria alone

  • This misidentification can have significant implications in clinical settings and research accuracy

• V-ATPase as an antifungal target:

  • The V-ATPase complex is essential for fungal growth and virulence

  • Assembly factors like VMA21 represent potential targets for novel antifungal development

  • Species-specific differences in VMA21 could be exploited for selective targeting

• Comparative biology approaches:

  • Studying the fungal VMA21 protein provides insights into evolutionarily conserved mechanisms

  • Cross-species comparison can identify both conserved domains and species-specific regions suitable for targeted drug development

The insights gained from studying fungal VMA21 can contribute to our understanding of basic cellular processes and potentially lead to novel therapeutic approaches for both fungal infections and human V-ATPase-related disorders.

What therapeutic implications arise from studying VMA21's role in lysosomal function and lipophagy?

The mechanistic insights from VMA21 research have important therapeutic implications:

Potential Therapeutic Approaches:

Research on VMA21 deficiency has revealed that defective lipophagy is a key mechanism underlying lipid droplet accumulation in hepatocytes. This finding has broader relevance for understanding the pathophysiology of non-alcoholic fatty liver disease (NAFLD) and other common metabolic conditions .

The connection between V-ATPase assembly defects and steatohepatitis provides a novel framework for developing therapies that target autophagy and lysosomal function. As noted in the research, "insights from rare genetic diseases can hold important lessons for common diseases and indicate treatment targets for both" .