Recombinant Neosartorya fumigata Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; AFUB_065230; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Target Names
rcf1
Target Protein Sequence
MLNEPLPSSMEDNPQFKEETSLQKFRRRLKEEPLIPLGCAATCYALYRAYRSMKAGDSVE MNKMFRARIYAQFFTLVAVVAGGMYYKTERQQRREFEKMVEQRKAQEKRDAWLRELEIRD KEDKDWRERHAAIEAAAKEAGKRPAPKKLPEQDAARSAIEPADERSIGVLSAVRDLWMQQ K
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata and what is its relationship to Aspergillus fumigatus?

Neosartorya fumigata and Aspergillus fumigatus refer to the same organism, with Neosartorya fumigata being used in some taxonomic classifications. Aspergillus fumigatus is a species of fungus in the genus Aspergillus and is one of the most common Aspergillus species to cause disease in immunocompromised individuals. It is typically found in soil and decaying organic matter, where it plays essential roles in carbon and nitrogen recycling. The fungus produces thousands of minute grey-green conidia (2-3 μm) which easily become airborne and can be inhaled by humans . Originally thought to reproduce only asexually, it was discovered in 2008 that A. fumigatus possesses a fully functional sexual reproductive cycle, 145 years after its original description .

What are the general characteristics of mitochondrial proteins in pathogenic fungi?

Mitochondrial proteins in pathogenic fungi, like those in other eukaryotes, are involved in essential cellular processes including energy production, cellular respiration, and metabolic regulation. In pathogenic fungi such as A. fumigatus, mitochondrial proteins may additionally contribute to virulence through roles in stress response, adaptation to hypoxic environments within the host, and resistance to host immune defenses. A. fumigatus encounters hypoxic microenvironments (≤1% oxygen) at infection sites, and its ability to adapt to these conditions correlates with pathogenicity and clinical outcomes . Mitochondrial proteins often function in protein complexes and may be encoded by either nuclear or mitochondrial genomes, with their expression and activity regulated in response to environmental conditions.

How can researchers confirm the subcellular localization of aim31 in Neosartorya fumigata?

To confirm the mitochondrial localization of aim31, researchers should employ multiple complementary approaches:

  • Bioinformatic analysis: Use prediction algorithms such as MitoProt, TargetP, and PSORT to analyze the protein sequence for mitochondrial targeting signals.

  • Fluorescence microscopy: Generate fusion constructs with GFP or other fluorescent proteins attached to aim31, transform A. fumigatus with these constructs, and visualize the subcellular localization using confocal microscopy. Co-staining with mitochondrial-specific dyes like MitoTracker can confirm mitochondrial localization.

  • Subcellular fractionation: Isolate mitochondria from A. fumigatus using differential centrifugation, then verify aim31 presence using Western blotting with antibodies against the recombinant protein.

  • Immunogold electron microscopy: Utilize antibodies against aim31 conjugated to gold particles for ultrastructural localization at the electron microscopy level.

What expression systems are suitable for producing recombinant Neosartorya fumigata mitochondrial proteins?

Several expression systems can be used for recombinant production of fungal mitochondrial proteins:

  • E. coli-based expression: Most commonly used due to ease of manipulation, rapid growth, and high protein yields. The RODA protein from Neosartorya fumigata has been successfully produced in E. coli with a His-B2M tag . For mitochondrial proteins, careful optimization of codons and expression conditions is necessary to prevent inclusion body formation.

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris may provide better folding conditions for eukaryotic proteins and appropriate post-translational modifications.

  • Filamentous fungi expression: Homologous expression in A. fumigatus or heterologous expression in Aspergillus niger or Aspergillus oryzae can maintain native folding and post-translational modifications.

  • Insect or mammalian cell expression: For proteins requiring complex folding or specific modifications not achievable in microbial systems.

Expression SystemAdvantagesLimitationsSuitable for aim31?
E. coliHigh yield, ease of manipulation, cost-effectiveLimited post-translational modificationsYes, with optimization
YeastEukaryotic system, secretion possibleLower yields than E. coliYes
Filamentous fungiNative modifications, proper foldingComplex manipulation, longer growth timesHighly suitable
Insect/Mammalian cellsComplex modifications, proper foldingExpensive, low yieldsFor specialized studies

What methodologies are recommended for studying aim31 protein interactions with other mitochondrial components?

For studying aim31 protein interactions, researchers should consider these advanced methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against aim31 to pull down protein complexes, followed by mass spectrometry analysis to identify interacting partners. This requires generating high-quality antibodies against recombinant aim31 or using epitope-tagged versions.

  • Proximity-dependent biotin identification (BioID): By fusing a promiscuous biotin ligase to aim31, proteins in close proximity become biotinylated and can be isolated for identification using streptavidin purification and mass spectrometry.

  • Yeast two-hybrid screening: Although more prone to false positives, this can provide initial candidates for interaction studies, especially when performed with cDNA libraries from A. fumigatus exposed to relevant stress conditions.

  • Microscale thermophoresis (MST) or surface plasmon resonance (SPR): For quantitative measurements of direct protein-protein interaction affinities between purified aim31 and candidate interacting partners.

  • Cryo-electron microscopy: For structural analysis of aim31 within larger mitochondrial complexes, providing insights into physical interactions at the molecular level.

Each approach has strengths and limitations, so combining multiple methods yields the most reliable results for mapping the interactome of aim31.

How does aim31 potentially contribute to Aspergillus fumigatus pathogenesis and virulence?

While specific information on aim31's role in virulence is limited, several mechanistic hypotheses can be proposed based on knowledge of mitochondrial proteins in pathogenic fungi:

  • Adaptation to hypoxic environments: A. fumigatus encounters hypoxic microenvironments within infected tissues . If aim31 contributes to respiratory adaptation under low oxygen, it may support fungal persistence in these conditions. Researchers should examine aim31 expression levels under normoxic versus hypoxic conditions and assess the phenotype of aim31 deletion mutants under oxygen limitation.

  • Stress response: Mitochondrial proteins often contribute to resistance against oxidative stress from host immune cells. The innate immune response to A. fumigatus involves neutrophil-mediated NADPH-oxidase induced damage , and aim31 may participate in mitigating this damage.

  • Metabolic flexibility: A. fumigatus can utilize various nitrogen sources, which affects its virulence . If aim31 influences metabolic pathways, it could impact growth in different host niches.

  • Morphological transitions: Mitochondrial function can influence hyphal growth, which is essential for tissue invasion.

Experimental approaches should include:

  • Generating aim31 deletion and overexpression strains

  • Comparing virulence in appropriate animal models

  • Measuring survival under host-relevant stress conditions

  • Monitoring morphological development in vitro and in vivo

What experimental approaches can detect structural and functional changes in aim31 under different environmental conditions?

To investigate how aim31 structure and function change under various conditions:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose purified aim31 to different conditions (pH, temperature, hypoxia)

    • Monitor deuterium incorporation patterns to identify regions with altered solvent accessibility

    • Map structural dynamics under conditions mimicking host environments

  • Circular dichroism (CD) spectroscopy:

    • Measure changes in secondary structure elements under varying conditions

    • Compare thermal stability profiles to assess protein robustness

  • Differential scanning fluorimetry (DSF):

    • Screen for conditions or ligands that stabilize/destabilize aim31

    • Identify potential cofactors or substrates

  • Site-directed mutagenesis coupled with functional assays:

    • Generate mutations in predicted functional domains

    • Assess impact on mitochondrial function using respiration measurements, membrane potential assays, and metabolic profiling

    • Compare mutant phenotypes under standard conditions versus stress conditions

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Identify proximity relationships between protein regions

    • Compare cross-linking patterns under different conditions to detect conformational changes

These approaches together can provide mechanistic insights into how aim31 responds to environmental changes during host colonization and infection.

How do hypoxic conditions affect aim31 expression and function during fungal infection?

The response of A. fumigatus to hypoxia is critical for its pathogenesis . To investigate aim31's role in hypoxic adaptation:

  • Expression analysis:

    • Quantify aim31 mRNA and protein levels under normoxic versus hypoxic conditions (1%, 0.5%, and 0.2% O₂)

    • Determine if hypoxia-responsive transcription factors (like SrbA and SrbB mentioned in search result #4) regulate aim31 expression

    • Use reporter constructs with aim31 promoter to monitor real-time expression changes

  • Deletion phenotyping:

    • Compare growth rates of wild-type and Δaim31 strains under hypoxia

    • Assess mitochondrial morphology and membrane potential changes

    • Measure oxygen consumption rates and metabolic profiles

  • Host-relevant models:

    • Establish 3D tissue culture models with oxygen gradients

    • Monitor aim31 expression in fungal cells during infection using fluorescent reporters

    • Compare virulence of wild-type and Δaim31 strains in immunocompromised mouse models

  • Metabolic adaptation analysis:

    • Measure changes in metabolic pathways when aim31 is deleted under hypoxia

    • Profile mitochondrial proteome alterations in response to aim31 deletion and hypoxia

    • Identify compensatory mechanisms activated in absence of aim31

Oxygen LevelExpected aim31 ExpressionPotential Metabolic ChangesMitochondrial Morphology
21% (normoxia)BaselineStandard respiratory metabolismNormal, tubular networks
1% (hypoxia)UpregulatedShift to glycolysisFragmented, increased fission
0.2% (severe hypoxia)Highly upregulatedAlternative respiration pathwaysHighly fragmented

What are the methodological considerations for studying interactions between aim31 and host immune cells?

Investigating how aim31 might influence host-pathogen interactions requires specialized approaches:

  • Recombinant protein challenges:

    • Expose different immune cell types (macrophages, neutrophils, dendritic cells) to purified recombinant aim31

    • Measure cytokine production, ROS generation, and cell signaling responses

    • Compare responses to wild-type protein versus mutated versions

  • Fungal interaction studies:

    • Compare immune cell responses to wild-type versus Δaim31 A. fumigatus strains

    • Assess phagocytosis rates, phagolysosomal maturation, and fungal killing

    • Monitor activation of pattern recognition receptors (PRRs) like TLRs and Dectin-1

  • Extracellular vesicle analysis:

    • Isolate fungal extracellular vesicles and determine if aim31 is a cargo component

    • Investigate if these vesicles modulate immune responses

  • Signaling pathway investigation:

    • Examine if aim31-containing preparations affect Wnt-β-Catenin signaling in dendritic cells, which has been shown to induce PD-L1 and promote regulatory T cell responses

    • Assess MAPK, NF-κB, and inflammasome activation in immune cells

  • Ex vivo systems:

    • Use precision-cut lung slices or 3D organoid cultures to model complex tissue interactions

    • Compare responses to wild-type and Δaim31 strains in these more physiologically relevant models

These methodologies build upon established approaches for studying A. fumigatus-immune cell interactions, as described in search result #1, which mentions various immune responses to the fungus, including alveolar macrophage phagocytosis, neutrophil recruitment, and pattern recognition receptor engagement .

What are the current gaps in knowledge regarding aim31 function and expression?

Despite the importance of mitochondrial proteins in fungal pathogenesis, significant knowledge gaps exist regarding aim31 in Neosartorya fumigata:

  • The precise biochemical function of aim31 remains undefined

  • Regulatory mechanisms controlling aim31 expression under different conditions are unclear

  • The specific contribution of aim31 to virulence and pathogenesis requires further elucidation

  • Structural information about aim31 is limited, hampering structure-based functional predictions

  • The complete interactome of aim31 within fungal mitochondria has not been mapped

  • The evolutionary conservation and divergence of aim31 across pathogenic and non-pathogenic fungi needs systematic investigation

Addressing these knowledge gaps through the methodological approaches outlined in this FAQ will significantly advance our understanding of mitochondrial biology in pathogenic fungi and potentially reveal new targets for antifungal intervention.

How might research on aim31 contribute to novel antifungal development strategies?

Research on aim31 could contribute to antifungal development through several avenues:

  • Target validation: If aim31 proves essential for A. fumigatus virulence or adaptation to host environments, it could represent a novel drug target. Compounds that specifically inhibit aim31 function might reduce fungal pathogenicity without affecting human mitochondrial proteins.

  • Combination therapies: Understanding how aim31 contributes to stress response could inform combination approaches with existing antifungals. The search results mention that antifungal drugs like voriconazole or lipid formulations of amphotericin B can promote pro-inflammatory immune responses to A. fumigatus hyphae, suggesting immunomodulatory potential in combination therapies .

  • Host-directed therapies: If aim31 interacts with or modulates host immune responses, this knowledge could guide development of host-directed therapies, similar to the use of exogenous IFN-γ as an immunological adjunct to antifungal therapy mentioned in search result #1.

  • Diagnostic applications: Antibodies against aim31 or detection of aim31 in patient samples could potentially serve as biomarkers for invasive aspergillosis, improving early diagnosis.

  • Vaccine development: Understanding aim31's role in fungal physiology could inform development of attenuated strains or recombinant subunit vaccines, building on the approach mentioned in search result #1 regarding the vaccination potential of Aspergillus-pulsed dendritic cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.