Recombinant Neosartorya fumigata Chitin synthase D (chsD)

Shipped with Ice Packs
In Stock

Description

Biological Function and Genetic Insights

ChsD belongs to Class VI of fungal chitin synthases (Family 2) and catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to form chitin polymers. Key functional insights include:

  • Role in Chitin Synthesis: Disruption of chsD reduces total mycelial chitin content by 20% but does not alter morphology or virulence in murine aspergillosis models .

  • Enzyme Activity: Despite its contribution to chitin content, chsD deletion does not significantly reduce chitin synthase (CHS) activity in vitro, likely due to compensation by other CHS isoforms .

  • Genetic Redundancy: chsD works cooperatively with other Family 2 CHS enzymes (e.g., CSMA, CSMB) to maintain cell wall integrity, as shown in quadruple mutants (ΔcsmA/csmB/F/D) with disorganized cell walls and reduced pathogenicity .

Research Applications

Recombinant chsD is primarily utilized in:

  • Enzyme Activity Assays: Measuring chitin polymerization kinetics using radiolabeled UDP-GlcNAc .

  • Antifungal Drug Screening: Evaluating inhibitors targeting chitin biosynthesis pathways .

  • Structural Studies: Investigating substrate binding and catalytic mechanisms via mutagenesis .

Comparative Analysis of chsD Mutants

ParameterWild-Type StrainΔchsD MutantQuadruple Family 2 Mutant (ΔcsmA/csmB/F/D)
Chitin Content100%80% No significant change
CHS ActivityBaselineUnchanged Reduced activity in conidia
Pathogenicity (Murine Model)HighUnaffected Reduced virulence
Cell Wall OrganizationNormalNormalDisrupted, hydrophilic conidia

Industrial and Clinical Relevance

  • Biotechnological Use: Recombinant chsD is commercially available for research (e.g., Creative BioMart, MyBioSource) with ≥85% purity standards .

  • Therapeutic Potential: Family 2 CHS enzymes, including chsD, are emerging targets for echinocandin-class antifungals, which exploit cell wall vulnerabilities .

Challenges and Future Directions

While chsD is non-essential for A. fumigatus survival, its role in chitin synthesis highlights the complexity of fungal cell wall biosynthesis. Future studies should focus on:

  • Structural resolution of chsD to guide inhibitor design.

  • Synergistic targeting of multiple CHS isoforms to overcome antifungal resistance.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
chsD; AfA5C5.045; AFUA_1G12600; Chitin synthase D; Chitin-UDP acetyl-glucosaminyl transferase D; Class-VI chitin synthase D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-745
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
chsD
Target Protein Sequence
MIVLFTLLRWAPISPVFSMRTMHANLAHRGIFLPVMIVTLPLPVHLRRRFPAQMVLMLQW FAFGMFSVLLIIPWLLCVYRLVTHSPGRTKRIKQVLDDRTAPKTVVVMPVYKEAPETLIR AIDSVVDCDYPANCIHVFLSYDGCLIDESYLRLIEHLGIPITLESYPQSIDVTYKDARIT VSRFKHGGKRHCQKQTFRLIDMVYADYLERHDNLFVLFIDSDCILDRVCLQNFMYDMELK PGSKHDMLAMTGVITSTTDRGSLLTLLQDMEYVHGQLFERSVESSCGAVTCLPGALTMLR FSAFRKMAKYYFADKAEQCEDFFDYGKCHLGEDRWLTHLFMVGARKRYQIQMCAGAFCKT EAVQTFSSLLKQRRRWFLGFITNEVCMLTDVRLWKRYPLLCLVRFMQNTIRTTALLFFII ALSLITTSSSINDLPVGFIAISLGLNYVLMFYLGAKLKRYKAWLFPLMFILNPFFNWLYM VYGILTAGQRTWGGPRADAATADEHTSPEEAVELAKAQGDELNVDLTTFRSRGDEKSVPI HPSEKIDGRFSAPELPDGYDSNLNDSNAALTELMTPLPSVPRIGIHTYPSSDSILTSDSL SSIHLPLKVEELTGDNDNMKPYPDRQPRDTSSLHQMQRTCSNGIVASDSCSSQDDASEMV NKPEILSPSAHILPHPSQATESSSGEDIYPLHLPSPHQHEAHFAPLNASTRGSMEGNTPE VQRPRRKLPGIPRPIRAQKDPESMV
Uniprot No.

Target Background

Function
Chitin synthase D (chsD) from *Neosartorya fumigata* is an enzyme that catalyzes the polymerization of chitin, a structural polymer found in the cell wall and septum. It functions by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer.
Database Links
Protein Families
Chitin synthase family, Class VI subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata Chitin synthase D and what is its role in fungal biology?

Chitin synthase D (chsD) is a Class-VI chitin synthase enzyme (EC 2.4.1.16, also known as Chitin-UDP acetyl-glucosaminyl transferase D) found in Neosartorya fumigata, which is synonymous with Aspergillus fumigatus. This enzyme belongs to family 2 of chitin synthases in A. fumigatus, alongside CHSF, CSMA, and CSMB . Chitin synthases are essential enzymes responsible for the biosynthesis of chitin, a crucial structural component of the fungal cell wall that provides rigidity and protection.

How does chsD differ from other chitin synthases in Aspergillus fumigatus?

Aspergillus fumigatus possesses eight chitin synthase genes divided into two distinct families:

  • Family 1: CHSA, CHSB, CHSC, and CHSG

  • Family 2: CHSF, CHSD, CSMA, and CSMB

These families are thought to have originated from an ancient divergence in fungi but work cooperatively to synthesize chitin in A. fumigatus. Specific differences include:

  • Class designation: chsD belongs to Class VI chitin synthases within Family 2

  • Functional impact: Deletion studies have shown that among Family 2 members, phenotypic defects mainly result from CSMA deletion rather than chsD deletion

  • Evolutionary conservation: Phylogenetic analyses place chsD in a distinct clade within the broader chitin synthase evolutionary tree

  • Genomic context: Unlike some other chitin synthases, chsD may be part of a conserved cell wall metabolism gene cluster, particularly in members of the Aspergillus genus

What are the optimal conditions for recombinant expression of chsD?

The optimal conditions for recombinant expression of Neosartorya fumigata chsD depend on the expression system chosen. Based on current research practices:

  • Expression systems:

    • E. coli: Commonly used for initial expression attempts, though fungal proteins may form inclusion bodies

    • Yeast systems (Pichia pastoris or Saccharomyces cerevisiae): Often provide better folding for fungal proteins

    • Insect cell lines: Can be effective for large, complex eukaryotic proteins

  • Expression parameters:

    • Temperature: Lower temperatures (16-25°C) often improve solubility

    • Induction: Gentle induction with lower concentrations of inducer

    • Media supplementation: Addition of glycerol (50%) in storage buffer has been shown to stabilize the recombinant protein

  • Storage recommendations:

    • Short-term storage: 4°C for up to one week

    • Long-term storage: -20°C or -80°C with 50% glycerol

    • Avoid repeated freeze-thaw cycles as this can reduce enzymatic activity

The tag type for recombinant chsD is typically determined during the production process to optimize expression and purification outcomes. Tris-based buffers with 50% glycerol have been successfully used for stabilizing the recombinant protein .

What methods are effective for studying chsD function in vivo?

Several methodological approaches have proven effective for studying chsD function in vivo:

  • Gene deletion strategies:

    • The β-rec/six system has been successfully employed for creating single and multiple chitin synthase gene deletions in A. fumigatus, allowing for the generation of complex mutants (up to quadruple deletions)

    • CRISPR-Cas9 approaches can also be used for targeted gene editing

  • Phenotypic analysis methods:

    • Radial growth measurement on solid media

    • Conidiation quantification

    • Microscopic examination of mycelial and conidial morphology

    • Chitin content determination using specific stains or biochemical assays

    • Enzyme activity assays for Chs activity

  • Virulence assessment models:

    • Animal models of aspergillosis to assess pathogenicity changes

    • Galleria mellonella (wax moth larvae) can be used as a less complex model for initial virulence testing

    • Cell culture-based infection models

  • Antifungal susceptibility testing:

    • Standardized protocols for testing susceptibility to cell wall-targeting antifungals

    • Growth inhibition assays in the presence of various antifungal compounds

How can researchers accurately measure chsD enzyme activity?

Accurate measurement of chsD enzyme activity requires carefully optimized biochemical assays:

  • Substrate preparation:

    • Use of radioactive or fluorescently labeled UDP-N-acetylglucosamine as substrate

    • Preparation of appropriate acceptor molecules (chitin oligomers)

  • Reaction conditions:

    • Buffer optimization (typically Tris-based buffers at pH 6.5-8.0)

    • Divalent cation requirements (Mg²⁺ or Mn²⁺)

    • Temperature optimization (usually 25-30°C for fungal enzymes)

  • Activity detection methods:

    • Radiometric assays measuring incorporation of labeled substrate into insoluble chitin

    • Colorimetric assays based on coupled enzyme reactions

    • HPLC or mass spectrometry-based product detection

  • Controls and validation:

    • Inclusion of known chitin synthase inhibitors (nikkomycin Z, polyoxins)

    • Heat-inactivated enzyme controls

    • Substrate specificity controls

What phenotypic changes occur in chsD deletion mutants?

Deletion studies of chsD in Aspergillus fumigatus have revealed the following phenotypic changes:

These findings indicate that while chsD alone may not be essential for normal growth, it plays an important role in cell wall organization when working in concert with other chitin synthases in the fungal cell wall synthesis machinery.

How does chsD contribute to fungal pathogenicity and virulence?

The contribution of chsD to fungal pathogenicity involves several mechanisms:

The research demonstrates that chitin biosynthesis, including the contribution from chsD, is essential for vegetative growth, resistance to antifungal drugs, and virulence of A. fumigatus .

What is the relationship between chsD and other cell wall components?

Chitin synthase D functions within a complex network of cell wall biosynthesis enzymes and regulatory proteins:

This genomic organization suggests that chsD operates within a coordinated network of cell wall synthesis and remodeling enzymes, highlighting the integrated nature of fungal cell wall biogenesis.

How can recombinant chsD be used for antifungal drug development?

Recombinant chsD presents several opportunities for antifungal drug development:

  • Target-based screening:

    • Purified recombinant chsD can be used in high-throughput biochemical assays to screen for specific inhibitors

    • Structure-activity relationship studies can guide optimization of lead compounds

  • Structural studies:

    • Crystallographic or cryo-EM studies of recombinant chsD can provide detailed structural information

    • Structure-based drug design approaches can identify potential binding pockets for inhibitor development

  • Rational peptide design:

    • Recent research has shown success with rationally designed antifungal peptides targeting cell wall components

    • Similar approaches could be applied to develop peptides specifically targeting chitin synthase function

  • Combination therapy approaches:

    • Understanding the cooperative nature of chitin synthases can inform strategies for combination therapies

    • Targeting multiple chitin synthases simultaneously may overcome functional redundancy and increase efficacy

  • Resistance monitoring:

    • Recombinant chsD variants can be used to study potential resistance mechanisms

    • This information can guide the development of next-generation inhibitors less susceptible to resistance

The specificity of chitin synthases to fungi (absent in human cells) makes them attractive targets for antifungal development with potentially lower host toxicity .

What are the phylogenetic relationships between chsD and chitin synthases in other fungi?

Phylogenetic analyses of fungal chitin synthases reveal important evolutionary relationships:

  • Classification system:

    • Chitin synthases are divided into seven distinct classes across fungal species

    • The distribution of these classes varies considerably between species

  • Evolutionary patterns:

    • ChsD belongs to family 2 of chitin synthases, which appears to have an ancient evolutionary origin

    • Large-scale phylogenetic classification has identified patterns in the distribution of chitin synthases related to fungal taxonomy

    • The most prominent patterns relate to the type of fungal growth (yeast vs. filamentous)

  • Phylogenetic clustering:

    • Class IV chitin synthases (the most abundant and widely distributed class) show distinct phylogenetic patterns

    • Analysis of 81 sequences identified as belonging to Class IV revealed five distinct clades:

      • Clade 1 (blue): Ascomycota filamentous fungi

      • Clade 2 (red): Ascomycota that grow as yeast or pseudohyphae

      • Clades 3 (green) and 4 (purple): Filamentous Basidiomycota and Mucoromycotina

      • Clade 5 (brown): Microsporidia and Chytridiomycota

  • Syntenic relationships:

    • Analysis of genomic blocks centered on ChspIV genes identified conserved gene arrangements

    • Members of the genus Aspergillus show particularly high conservation of gene order, with orthologs of 15 out of 31 genes identified across six species

These phylogenetic relationships provide important context for understanding the evolution and functional specialization of chitin synthases across the fungal kingdom.

How can researchers overcome challenges in working with membrane-bound enzymes like chsD?

Working with membrane-bound enzymes such as chitin synthases presents several unique challenges that researchers can address through specialized approaches:

  • Solubilization strategies:

    • Optimization of detergent types and concentrations (mild non-ionic detergents like DDM or digitonin)

    • Use of amphipols or nanodiscs to maintain native membrane environment

    • Testing different solubilization conditions (temperature, salt concentration, pH)

  • Expression systems modifications:

    • Use of eukaryotic expression systems that properly process membrane proteins

    • Co-expression with chaperones to improve folding

    • Creation of fusion proteins with solubility-enhancing tags

    • Expression of soluble domains for initial characterization

  • Stability enhancement:

    • Addition of stabilizing agents like glycerol (50% has been shown effective)

    • Inclusion of specific lipids that interact with the protein

    • Storage at appropriate temperatures (-20°C to -80°C for long-term)

    • Avoiding repeated freeze-thaw cycles which can reduce enzymatic activity

  • Activity assay adaptations:

    • Development of detergent-compatible activity assays

    • Reconstitution into liposomes or proteoliposomes for more native-like conditions

    • Use of membrane fractions rather than purified protein for initial activity screening

  • Structural studies approaches:

    • Cryo-electron microscopy as an alternative to crystallography

    • Limited proteolysis to identify stable domains

    • Computational modeling based on homologous proteins with known structures

These methodological adaptations can significantly improve the chances of successfully working with challenging membrane proteins like chitin synthases.

What are the optimal storage conditions for maintaining recombinant chsD activity?

Maintaining the stability and activity of recombinant chsD requires careful attention to storage conditions:

  • Buffer composition:

    • Tris-based buffers optimized for this specific protein

    • Inclusion of 50% glycerol as a stabilizing agent

    • Potential addition of reducing agents to maintain cysteine residues

  • Temperature considerations:

    • Working aliquots: 4°C for up to one week

    • Medium-term storage: -20°C

    • Long-term storage: -20°C or -80°C

  • Handling recommendations:

    • Avoid repeated freeze-thaw cycles as they can significantly reduce enzymatic activity

    • Prepare small working aliquots to minimize freeze-thaw events

    • When thawing, do so rapidly at room temperature or in a water bath, then keep on ice

  • Quality control measures:

    • Regular activity testing of stored samples

    • Monitoring for aggregation or precipitation

    • Assessment of purity through SDS-PAGE or size exclusion chromatography

These guidelines help ensure that recombinant chsD maintains its structural integrity and enzymatic activity during storage, maximizing its utility for research applications.

What controls should be included in chsD functional studies?

Proper experimental controls are essential for rigorous chsD functional studies:

  • Enzymatic activity controls:

    • Positive control: Known active chitin synthase preparations

    • Negative control: Heat-inactivated enzyme

    • Substrate specificity control: Reaction without UDP-N-acetylglucosamine

    • Inhibitor control: Addition of known chitin synthase inhibitors (nikkomycin Z)

  • Genetic manipulation controls:

    • Wild-type parental strain for comparison to deletion mutants

    • Empty vector control for overexpression studies

    • Complementation controls where the deleted gene is reintroduced

    • Single mutation controls when studying multiple gene deletions

  • Pathogenicity assessment controls:

    • Non-infected animals or cells for in vivo/in vitro models

    • Alternative pathogen controls to differentiate specific vs. general effects

    • Hemolysis assay negative controls (sterile water) and positive controls (Triton X-100)

    • For Galleria mellonella toxicity assays: insect physiological saline as non-toxic control and Triton X-100 as positive toxicity control

  • Structural/localization controls:

    • Non-specific binding controls for antibody staining

    • Subcellular fractionation markers

    • Tagged protein controls for localization studies

These comprehensive controls ensure that experimental results can be confidently attributed to chsD function rather than technical artifacts or secondary effects.

How can researchers distinguish between the functions of different chitin synthases in Aspergillus fumigatus?

Differentiating the specific functions of individual chitin synthases in A. fumigatus requires sophisticated experimental approaches:

  • Genetic approaches:

    • Systematic single and multiple gene deletions using the β-rec/six system or CRISPR-Cas9

    • Construction of strain series with deletions in specific combinations across both families

    • Gene replacements with fluorescently tagged versions for localization studies

    • Promoter swapping to alter expression patterns

  • Phenotypic analysis:

    • Comprehensive phenotyping matrix comparing growth, morphology, chitin content, and susceptibility to stressors across mutant series

    • Quantitative measurements rather than qualitative observations

    • Time-course studies to identify temporal differences in chitin synthase function

    • Stress-specific responses that may highlight specialized roles

  • Biochemical differentiation:

    • Enzyme kinetics with different substrates to identify catalytic preferences

    • Inhibitor profiles to distinguish between different chitin synthases

    • Co-immunoprecipitation to identify specific protein interaction partners

    • Mass spectrometry to identify post-translational modifications

  • Systematic data analysis:

    • Construction of comparative tables showing phenotypic differences between single and combined mutants

Chitin SynthaseFamilyGrowth ImpactConidiationMorphology ChangesChs ActivityVirulence Impact
chsA1LimitedLimitedLimitedLimitedMinimal
chsB1LimitedLimitedLimitedLimitedMinimal
chsC1LimitedLimitedLimitedLimitedMinimal
chsG1ReducedReducedAlteredReducedMinimal
chsF2ModerateModerateModerateModerateModerate
chsD2LimitedLimitedLimitedLimitedLimited
csmA2SignificantSignificantSignificantSignificantSignificant
csmB2ModerateModerateModerateModerateModerate
  • Functional complementation:

    • Cross-species complementation to test functional conservation

    • Domain swapping between different chitin synthases to identify functional regions

These approaches collectively enable researchers to build a comprehensive understanding of the specific contributions of each chitin synthase, including chsD, to fungal biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.