Recombinant Neosartorya fumigata Chitin synthase export chaperone (chs7)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chitin Synthase Trafficking

Chs7 ensures the proper folding and endoplasmic reticulum (ER)-to-Golgi transport of Chs3, a class IV chitin synthase essential for synthesizing structural chitin in fungal cell walls. Key findings include:

  • ER Export Mechanism: Chs7 prevents Chs3 aggregation in the ER and facilitates its incorporation into COPII vesicles for secretory transport, analogous to Shr3-like chaperones in yeast .

  • Localization Dynamics: Unlike typical ER-resident proteins, Chs7 transiently associates with Chs3 and dissociates after Golgi arrival, ensuring Chs3’s plasma membrane activity .

  • Pathogenicity Link: In Candida albicans and Cryptococcus neoformans, Chs7 deletion reduces chitin content, disrupts hyphal morphogenesis, and attenuates virulence .

3.1. Fungal Cell Wall Studies

Recombinant Chs7 enables in vitro reconstitution of chitin synthase transport mechanisms. Studies in Neurospora crassa revealed that CSE-8 (a Chs7 orthologue) is required for CHS-3 localization at hyphal tips and septa, critical for polarized growth .

3.2. Antifungal Drug Development

Targeting Chs7 disrupts chitin synthase trafficking, compromising cell wall integrity. For example:

  • Aspergillus fumigatus mutants lacking CSMA (a Chs3-class synthase) show 50% reduced conidial chitin, increasing susceptibility to caspofungin .

  • In Magnaporthe oryzae, chs7 deletion blocks appressorium formation, preventing rice blast infection .

Comparative Insights Across Species

OrganismChs7 FunctionPhenotype of Δchs7 Mutant
Neosartorya fumigataChaperone for Chs3 ER exportNot directly studied; inferred from orthologues
Saccharomyces cerevisiaeER export of Chs3; retains 10% residual chitin in mutantsReduced chitin, defective budding
Ustilago maydisCritical for yeast-to-hypha transition and pathogenicityAberrant cell morphology, nonpathogenic
Neurospora crassaCSE-8 ensures CHS-3 delivery to SpitzenkörperHyphal polarity defects, disrupted septation

Future Directions

  • Mechanistic Studies: Resolve how Chs7 interacts with COPII machinery using cryo-EM .

  • Therapeutic Exploration: Screen small-molecule inhibitors of Chs7-Chs3 binding to develop broad-spectrum antifungals .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
chs7; AfA28D1.075c; AFUA_1G12040; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
chs7
Target Protein Sequence
MGFGQFDSICQKAALPLCSLVGPSSPISGSTGIIPNCYARNIELANTIIFEGAASFVHII ALGMTVIMILHVRSKFTAVGRKEIITFFYIYMALTICSLVIDAGVVPPRSGPFPYFVAVQ NGLSSALCTCLLINGFVGFQLYEDGTFLSVWLIRLTSAVMFVVSFLISLLTFKSWGGMSP TNTIALFVVLYILNAISIAIYLVMQLLLVMNTLEDRWPLGHIAFGVIVFICGQVLLYGFS DTICDNVQHYLDGLFFATFCNLLAVMMVYKFWDYITKEDLEFSVGIKPNTWEVKELLPEE DRRTTVYQDSHSEYAGSMYHHRASTYGGHNY
Uniprot No.

Target Background

Function
This protein functions as a chaperone, essential for the transport of chitin synthase chs3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata chitin synthase export chaperone (chs7)?

Neosartorya fumigata chitin synthase export chaperone (chs7) is an integral membrane protein that plays a crucial role in the regulation of chitin synthesis in fungi. Similar to its homolog in Saccharomyces cerevisiae, it is involved in facilitating the export of chitin synthase from the endoplasmic reticulum (ER) to its functional location. Chs7p in yeast directly influences chitin synthesis through the regulation of chitin synthase III (CSIII) activity, and in its absence, Chs3p (the catalytic component) is retained in the ER, leading to severe defects in chitin synthesis . The N. fumigata chs7 protein (UniProt ID: Q6MYT0) consists of 331 amino acids and functions as a specialized chaperone essential for proper fungal cell wall formation .

What is the molecular structure and characteristics of chs7?

The chs7 protein from Neosartorya fumigata (strain ATCC MYA-4609/Af293/CBS 101355/FGSC A1100) is a membrane-associated protein with specific structural features:

  • Full amino acid sequence of 331 residues

  • Contains multiple transmembrane segments consistent with its role as an integral membrane protein

  • Possesses hydrophobic regions that anchor it within the endoplasmic reticulum membrane

  • The protein sequence includes distinctive regions that facilitate specific interaction with chitin synthase enzymes

  • Likely adopts a conformation that enables it to escort chitin synthase through the secretory pathway

Research in Saccharomyces cerevisiae suggests that Chs7p specifically interacts with Chs3p to facilitate its exit from the ER, indicating a specialized chaperone function rather than a general role in protein secretion .

How does chs7 differ from other fungal export chaperones?

Chs7 represents a specialized class of export chaperones that demonstrates high substrate specificity. Unlike general chaperones involved in protein folding and quality control, chs7:

  • Functions specifically with chitin synthase enzymes, particularly in facilitating their transport from the ER

  • Does not affect the secretion of other proteins, indicating a highly specific chaperoning mechanism

  • Is regulated in coordination with chitin synthesis needs, with its expression increasing when elevated chitin synthesis is detected

  • Serves as a limiting factor for chitin synthase activity, evidenced by the observation in yeast that simply overexpressing chitin synthase does not increase activity unless chs7 is also overexpressed

This specificity distinguishes chs7 from general ER quality control machinery and places it among specialized export factors critical for fungal cell wall biogenesis.

What experimental approaches are most effective for studying chs7 function?

Effective investigation of chs7 function requires a multi-faceted approach:

Gene Expression Analysis:

  • qRT-PCR to measure CHS7 transcription levels under various conditions

  • RNA-seq to examine global expression changes in response to chs7 manipulation

  • Promoter analysis to identify regulatory elements controlling chs7 expression

Protein Localization Studies:

  • Fluorescent protein tagging to visualize chs7 trafficking and localization

  • Subcellular fractionation to confirm ER localization

  • Co-localization studies with chitin synthase enzymes to demonstrate physical association

Functional Assays:

  • Measure chitin synthase activity in wild-type versus chs7 deletion strains

  • Complementation studies to confirm phenotype rescue

  • Co-expression experiments with both chs7 and chitin synthase to assess functional relationships

Evidence from yeast models demonstrates that joint overexpression of CHS3 and CHS7 increases export of Chs3p from the ER with a concomitant increase in chitin synthase III activity, confirming that chs7 availability is rate-limiting for chitin synthesis .

How does the regulation of chs7 impact fungal pathogenicity?

The regulation of chs7 has significant implications for fungal pathogenicity, particularly for Neosartorya fumigata, which is a significant opportunistic pathogen:

  • Cell wall integrity: Proper chitin synthesis is essential for cell wall strength and integrity, directly affecting the fungus's ability to withstand host defense mechanisms.

  • Stress response: Upregulation of chs7 likely occurs during specific stress conditions encountered within the host environment.

  • Morphological transitions: Chitin synthesis is crucial during hyphal growth and morphological changes that facilitate tissue invasion.

  • Antifungal susceptibility: Altered chitin content in the cell wall can affect susceptibility to echinocandins and other antifungal agents.

The clinical significance of proper chitin regulation is highlighted by cases of invasive aspergillosis, where Neosartorya species cause persistent infections that can spread across anatomical planes and demonstrate resistance to standard therapies . The chronic nature of these infections suggests that cell wall components, including chitin, play a role in immune evasion and persistence.

What are the implications of chs7 for antifungal drug development?

As a specific regulator of chitin synthesis, chs7 presents several opportunities for antifungal drug development:

Target Validation:

  • Chs7 represents a potential novel target distinct from traditional cell wall synthesis inhibitors

  • Its specificity to fungi makes it potentially suitable for selective targeting

  • As a rate-limiting factor in chitin synthesis, its inhibition could effectively block cell wall formation

Resistance Considerations:

  • Fungal pathogens like Neosartorya species demonstrate variable susceptibility patterns to existing antifungals

  • N. udagawae infections, for example, have shown relatively higher minimum inhibitory concentrations to various agents compared to A. fumigatus sensu stricto

  • N. hiratsukae exhibits variable MIC values with azole-susceptible patterns but sporadic high itraconazole MIC values

Combination Therapy Potential:

Antifungal AgentPotential Synergy with chs7 InhibitionMechanism
EchinocandinsHighSimultaneous targeting of β-glucan and chitin synthesis
AzolesModerateCell membrane stress coupled with impaired cell wall synthesis
PolyenesModerate to HighMembrane disruption combined with weakened cell wall

The successful treatment of infections caused by Neosartorya species often requires combination therapy approaches , suggesting that targeting multiple cell wall components simultaneously could be an effective strategy.

What are the optimal conditions for expressing recombinant Neosartorya fumigata chs7 protein?

Optimal expression of recombinant N. fumigata chs7 requires careful consideration of expression systems and conditions:

Expression System Selection:

  • Yeast expression systems (particularly S. cerevisiae or P. pastoris) offer advantages for membrane protein expression with proper post-translational modifications

  • E. coli systems may require optimization for membrane protein expression, possibly using specialized strains (C41/C43) or fusion tags to improve membrane insertion

Expression Conditions:

  • Induction parameters: Lower temperatures (16-20°C) often improve membrane protein folding

  • Use of mild detergents during extraction to maintain protein conformation

  • Consider co-expression with fungal-specific chaperones to improve yield

Protein Stabilization:

  • Buffer optimization: Tris-based buffers with 50% glycerol have been successfully used for storage

  • Temperature management: Store working aliquots at 4°C for short-term use, with long-term storage at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles which can destabilize membrane proteins

When producing recombinant chs7, it's critical to verify protein integrity through functional assays to ensure that the recombinant protein retains its native chaperoning activity.

How can researchers effectively measure chs7-mediated chitin synthase activity?

Measuring chs7-mediated chitin synthase activity requires assessing both the chaperone function and the resulting impact on chitin synthesis:

Chaperone Function Assays:

  • ER export efficiency: Track trafficking of fluorescently tagged chitin synthase from ER to Golgi in the presence/absence of chs7

  • Co-immunoprecipitation to detect physical interaction between chs7 and chitin synthase

  • In vitro translation systems combined with reconstituted membrane vesicles to assess direct chaperoning activity

Chitin Synthase Activity Measurement:

  • Radioactive assays using [14C]-UDP-N-acetylglucosamine as substrate

  • Fluorescent substrate-based assays to measure enzyme kinetics

  • Cell wall chitin content analysis using calcofluor white staining and fluorescence microscopy

Experimental Design Considerations:

Experimental ApproachMeasurement ParametersControls Required
Genetic manipulationER retention of chitin synthaseWild-type, chs7Δ, chs7Δ + complementation
Biochemical assaysUDP-GlcNAc incorporation rateEnzyme-only, substrate-only, known inhibitors
MicroscopyCalcofluor white binding, chitin synthase localizationNon-specific binding controls, subcellular markers

Research in yeast has demonstrated that chs7 deficiency causes Chs3p retention in the ER, leading to a severe defect in chitin synthase III activity and consequently reduced chitin synthesis, with phenotypic manifestations including reduced mating efficiency and altered ascospore formation .

What approaches can be used to study chs7 in relation to fungal pathogenicity?

Investigating the relationship between chs7 and fungal pathogenicity requires integrating molecular techniques with infection models:

Molecular Genetic Approaches:

  • Generation of chs7 deletion, conditional, and point mutants to assess functional domains

  • Site-directed mutagenesis to identify critical residues for chaperone function

  • Promoter replacement strategies to control chs7 expression levels during infection

Infection Models:

  • Cell culture infection assays to measure adherence, invasion, and host cell responses

  • Murine models of invasive aspergillosis to assess virulence in vivo

  • Galleria mellonella larvae as an alternative infection model for initial virulence screening

Clinically Relevant Endpoints:

  • Susceptibility to host immune effectors (neutrophils, macrophages)

  • Resistance to environmental stresses encountered during infection

  • Ability to disseminate across tissue barriers

  • Response to antifungal treatment regimens

Clinical observations of Neosartorya infections highlight their chronic nature, with a median duration of 35 weeks for N. udagawae infections compared to 5.5 weeks for A. fumigatus sensu stricto infections . These infections typically spread across anatomical planes in a contiguous manner and demonstrate resistance to standard therapy, suggesting that cell wall components may contribute to this persistence.

How does the function of chs7 in Neosartorya compare to its homologs in other fungi?

The function of chs7 in Neosartorya can be contextualized by comparing it to well-studied homologs in other fungi:

Saccharomyces cerevisiae Chs7p:

  • Functions as an ER-resident membrane protein specifically required for export of Chs3p

  • Acts as a limiting factor for chitin synthase III activity

  • Transcription increases when elevated chitin synthesis is detected

  • Deletion causes retention of Chs3p in the ER and defects in chitin synthesis

  • Affects yeast phenotypes including reduced mating efficiency and altered ascospore formation

Comparative Functional Analysis:

FeatureS. cerevisiae Chs7pN. fumigata chs7Implications
Subcellular localizationER membraneLikely ER membraneConserved trafficking function
Substrate specificitySpecific for Chs3pLikely specific for chitin synthaseSpecialized rather than general chaperone
Impact on morphologyAffects mating and sporulationLikely affects hyphal growth and conidiationAdaptation to different life cycles
RegulationCoordinated with chitin synthesisLikely stress and growth-phase regulatedResponsiveness to environmental conditions

This comparative approach highlights the specialized nature of chitin synthase export chaperones across fungal species and suggests evolutionary adaptation of this mechanism to support species-specific morphological and developmental processes.

What are the emerging techniques for studying chs7 structure-function relationships?

Several cutting-edge techniques show promise for advancing our understanding of chs7 structure-function relationships:

Structural Biology Approaches:

  • Cryo-electron microscopy for membrane protein structure determination

  • Advanced NMR techniques for studying membrane protein dynamics

  • Computational modeling and molecular dynamics simulations to predict protein-protein interactions

Functional Genomics:

  • CRISPR-Cas9 genome editing for precise manipulation of chs7 and related genes

  • High-throughput mutagenesis coupled with phenotypic screening

  • Ribosome profiling to examine translational regulation of chs7

Interactomics:

  • Proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of chs7 in vivo

  • Synthetic genetic arrays to map genetic interactions of chs7

  • Split-reporter systems to visualize chs7-chitin synthase interactions in living cells

These emerging techniques will help resolve key questions about the specific mechanisms by which chs7 recognizes, binds, and facilitates the export of chitin synthase from the ER, potentially opening new avenues for antifungal development.

How might chs7 research contribute to understanding fungal evolution and adaptation?

Research on chs7 offers valuable insights into fungal evolution and adaptation:

  • Cell wall evolution: Chitin synthesis machinery represents an ancient and essential aspect of fungal biology. Comparative analysis of chs7 across fungal lineages can illuminate how specialized chaperones evolved to support complex cell wall architecture.

  • Pathogenicity emergence: Differences in chs7 function and regulation between environmental and pathogenic fungi may reveal adaptations that facilitate survival in host environments.

  • Drug resistance mechanisms: Changes in cell wall composition represent a known mechanism of antifungal resistance. Understanding how chs7 regulation contributes to cell wall remodeling could explain emerging resistance patterns.

  • Environmental adaptation: Regulation of chitin synthesis through chs7 likely plays a role in adaptation to different environmental niches, contributing to the remarkable ecological diversity of fungi.

The clinical observations of different Neosartorya species demonstrate significant variation in infection duration, tissue invasion patterns, and drug susceptibility , suggesting that cell wall components and their regulation have evolved differently even among closely related pathogenic species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.