Recombinant Neosartorya fumigata Cytochrome b (cob)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cob; cytB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Neosartorya fumigata (Aspergillus fumigatus)
Target Names
cob
Target Protein Sequence
WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALVIMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFVFKDLVTVFIFFIVLSVFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYAILRSI
Uniprot No.

Target Background

Function
Recombinant *Neosartorya fumigata* Cytochrome b (cob) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic relationship between Neosartorya fumigata and Aspergillus fumigatus?

Neosartorya fumigata is the teleomorph (sexual form) of Aspergillus fumigatus. Under the recent "one name, one fungus" nomenclature proposal, Aspergillus fumigatus is now the preferred name for this species despite the discovery of its sexual cycle. This taxonomic relationship was established through multiple molecular studies, including mitochondrial cytochrome b gene analysis, which confirmed that these are simply different forms of the same organism .

How can researchers differentiate between Neosartorya fumigata and related species using cytochrome b analysis?

Researchers can differentiate N. fumigata from related species using mitochondrial cytochrome b gene analysis through the following methodology:

  • DNA Extraction and PCR Amplification:

    • Extract total DNA from fungal isolates

    • Amplify a 426-bp fragment of the cytochrome b gene using specific primers

  • Sequence Analysis:

    • Sequence the amplified fragments

    • Compare nucleotide sequences to identify species-specific regions

  • Identification of Species-Specific Patterns:

    • As shown in research findings, all strains of A. fumigatus (including clinical isolates, var. fumigatus, var. ellipticus, and var. albus) share identical cytochrome b nucleotide sequences

    • Other species within Aspergillus section Fumigati (such as A. fumisynnematus, A. viridinutans, and A. duricaulis) possess distinct, characteristic nucleotide sequences

  • Phylogenetic Analysis:

    • Use the sequence data to construct nucleotide- and amino acid-based phylogenetic trees

    • Examine regions specific to section Fumigati to facilitate classification at the species level

This approach is particularly valuable for the identification of clinical isolates when morphological characteristics are insufficient due to pleomorphism or poor development of conidial structures .

What methodologies are most effective for analyzing structural variations in recombinant Neosartorya fumigata Cytochrome b?

For optimal analysis of structural variations in recombinant N. fumigata Cytochrome b, researchers should employ a multi-analytical approach:

a) Molecular Techniques:

  • Gene Sequencing and Comparison: Sequence the entire cytochrome b gene (including potential introns) and compare across strains to identify variations.

  • RFLP Analysis: Restriction fragment length polymorphism can reveal polymorphisms within the gene structure.

  • RAPD Analysis: Random amplified polymorphic DNA can be used to distinguish between strains, though results may be difficult to repeat due to low annealing temperatures .

  • Microsatellite Analysis: Four CA repeats have been identified: (CA)9(GA)25, (CA)2C(CA)23, (CA)8, and (CA)21, which provide rapid and highly reproducible strain discrimination .

b) Protein Analysis Techniques:

  • Mass Spectrometry: For detailed characterization of the recombinant protein structure.

  • X-ray Crystallography: To determine three-dimensional structure.

  • Circular Dichroism: To analyze secondary structure elements.

c) Functional Assays:

  • Electron Transfer Activity Measurements: To assess functional implications of structural variations.

  • Binding Assays: To determine how variations affect interactions with other components of the respiratory chain.

The most significant finding from previous research is that while the nucleotide sequences may vary between species, some strains like A. brevipes can produce proteins with identical amino acid sequences to A. fumigatus despite nucleotide differences, indicating the importance of both nucleotide and protein-level analyses .

How do mutations in cytochrome b contribute to antifungal resistance in Neosartorya fumigata?

Mutations in cytochrome b may contribute to antifungal resistance in N. fumigata through multiple mechanisms, although the direct relationship is still being fully investigated:

Resistance Mechanisms Related to Respiratory Chain:

  • Altered Drug Binding Sites: Mutations may alter the structure of cytochrome b, potentially affecting binding sites for antifungals that target the respiratory chain.

  • Metabolic Adaptation: Changes in cytochrome b can alter respiratory metabolism, potentially enabling the fungus to adapt to stress conditions imposed by antifungal treatments.

  • Energy Production Shifts: Mutations may allow the fungus to maintain energy production through alternative pathways when primary targets are inhibited.

Cross-Resistance Patterns:

Research has identified distinct antifungal susceptibility patterns among different species within Aspergillus section Fumigati:

SpeciesAmphotericin B (GM MICs)Itraconazole (GM MICs)Voriconazole (GM MICs)Ravuconazole (GM MICs)
A. lentulus & A. fumigatiaffinis≥4.5 μg/ml≥6 μg/ml≥3 μg/ml≥3 μg/ml
N. pseudofischeri & A. viridinutansVariable≥8 μg/ml≥3.33 μg/ml≥2 μg/ml
N. hiratsukae & A. fumisynnematusSusceptibleSusceptibleSusceptibleSusceptible

These patterns correlate with genetic differences, including those in mitochondrial genes such as cytochrome b .

What are the optimal expression systems and purification protocols for producing functional recombinant Neosartorya fumigata Cytochrome b?

Based on current research practices, the following optimized protocols can be recommended:

Expression Systems:

  • E. coli-Based Expression:

    • The most common system utilizes E. coli with a His-tag fusion for easier purification

    • Successful expression has been reported using pET expression vectors with T7 promoter systems

    • Codon optimization is crucial due to differences between fungal and bacterial codon usage

  • Yeast Expression Systems:

    • Pichia pastoris can be advantageous for maintaining proper protein folding

    • Saccharomyces cerevisiae systems are useful when post-translational modifications are important

Purification Protocol:

  • Cell Lysis and Initial Preparation:

    • For E. coli expressions: Sonication or pressure-based lysis in buffer containing 20-50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Include protease inhibitors to prevent degradation

  • Affinity Chromatography:

    • For His-tagged proteins: Ni-NTA affinity chromatography

    • Wash with imidazole gradients (20-50 mM)

    • Elute with higher imidazole concentration (250-300 mM)

  • Additional Purification Steps:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Storage Considerations:

    • Store in Tris-based buffer with 50% glycerol at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

The most critical factor for success is maintaining protein stability during purification, as Cytochrome b is a membrane-associated protein that can be challenging to maintain in its native conformation.

How can cytochrome b gene analysis be applied to study phylogenetic relationships and evolutionary history within Aspergillus section Fumigati?

Cytochrome b gene analysis provides a powerful tool for phylogenetic studies within Aspergillus section Fumigati through several methodological approaches:

Methodology for Phylogenetic Analysis:

  • Sequence Alignment and Comparison:

    • Align sequences of the 426-bp fragment of cytochrome b genes from multiple species

    • Identify conserved and variable regions

    • Distinguish section-specific regions from species-specific nucleotides (as shown in the research where boxed regions indicate species-specific nucleotides and hatched bars indicate section Fumigati-specific regions)

  • Phylogenetic Tree Construction:

    • Build nucleotide-based and amino acid-based trees using methods such as:

      • Maximum Likelihood

      • Neighbor-Joining

      • Bayesian inference

    • Evaluate tree robustness through bootstrap analysis

  • Molecular Clock Analysis:

    • Estimate divergence times between species based on mutation rates

Research Findings and Applications:

  • Species Delineation: Analysis has successfully separated closely related species such as A. fumigatus, A. lentulus, and A. fumisynnematus

  • Evolutionary History: Cytochrome b analysis has revealed evidence of RIP (repeat-induced point mutation) in A. fumigatus, suggesting this species may have lost its sexual cycle over evolutionary time

  • Reproductive Isolation: Studies combining cytochrome b analysis with mating experiments have shown that despite phylogenetic relatedness, some species like A. lentulus and A. fumigatus are reproductively isolated, preventing gene flow between species

  • Taxonomic Reclassification: Molecular evidence has supported taxonomic decisions, such as considering A. fumigatus var. ellipticus as a variety of A. fumigatus rather than a separate species (A. neoellipticus)

This approach has been particularly valuable in resolving taxonomic questions within the section Fumigati, which currently contains 25 different species with 8 anamorphs , and has helped establish evolutionary relationships that were previously unclear based solely on morphological characteristics.

What are the molecular mechanisms of interaction between recombinant Neosartorya fumigata Cytochrome b and other components of the respiratory chain?

The molecular interactions between N. fumigata Cytochrome b and other respiratory chain components involve specific structural domains and functional mechanisms:

Key Structural Domains Mediating Interactions:

  • Transmembrane Helices: The protein contains hydrophobic regions that anchor it within the inner mitochondrial membrane, positioning it correctly for interactions with other complex III components.

  • Quinone Binding Sites: Two distinct binding pockets (Qo and Qi sites) allow interaction with ubiquinol and ubiquinone respectively.

  • Iron-Sulfur Interaction Domains: Regions that facilitate electron transfer to the iron-sulfur protein (ISP) subunit of complex III.

Interaction with NADH-Cytochrome b5 Reductases:

N. fumigata possesses multiple NADH-cytochrome b5 reductases that interact with cytochrome b in the electron transport chain:

Functional Implications:

Research suggests these interactions are critical for:

  • Energy metabolism in N. fumigata

  • Adaptation to environmental stresses

  • Potential virulence factors in invasive aspergillosis

Understanding these interactions may provide insights into fungal metabolism that could be leveraged for the development of novel antifungal strategies that target respiratory chain functions.

How does the expression of recombinant Cytochrome b differ between clinical and environmental isolates of Neosartorya fumigata?

Research on the differences in cytochrome b expression between clinical and environmental isolates of N. fumigata reveals important distinctions:

Expression Patterns:

  • Clinical Isolates:

    • Studies using mitochondrial cytochrome b gene analysis have shown that clinical isolates of A. fumigatus from different sources have nucleotide sequences identical to each other and to the ex-type isolate of A. fumigatus var. fumigatus

    • This genetic homogeneity suggests consistent expression patterns across clinical isolates

    • Clinical isolates accurately identified as A. fumigatus show consistent cytochrome b expression profiles, indicating reliable identification of this pathogen in clinical settings

  • Environmental Isolates:

    • Environmental isolates show greater diversity in cytochrome b sequences compared to clinical isolates

    • Some environmental strains may carry introns within the cytochrome b gene, affecting expression

    • A study of A. brevipes found that one strain produced a 1,500-bp fragment that included an intron, while another produced a 426-bp fragment without an intron

Methodological Approach to Studying Expression Differences:

  • Gene Expression Analysis:

    • RT-PCR to quantify mRNA levels

    • RNA-Seq for comprehensive transcriptomic profiling

    • Northern blotting for specific transcript detection

  • Protein Expression Analysis:

    • Western blotting with specific antibodies

    • Proteomic approaches using mass spectrometry

  • Functional Assessments:

    • Respiration rate measurements

    • Electron transport chain activity assays

The correlation between cytochrome b expression patterns and virulence or antifungal resistance remains an active area of research, with potential implications for understanding pathogenicity mechanisms in N. fumigata.

What is the impact of cytochrome b mutations on the pathogenicity of Neosartorya fumigata in immunocompromised hosts?

The relationship between cytochrome b mutations and N. fumigata pathogenicity in immunocompromised hosts involves complex interactions:

Pathogenicity Mechanisms Potentially Affected by Cytochrome b Mutations:

  • Energy Production and Stress Adaptation:

    • Mutations affecting electron transport efficiency may alter the fungus's ability to adapt to host environments

    • Changes in energy metabolism could impact growth rates under stress conditions encountered in the host

  • Virulence in Immunocompromised Models:

    • Studies have demonstrated that even attenuated strains can cause significant disease in immunocompromised hosts

    • For example, the Δcyp51A strain of A. lentulus was morphologically indistinguishable from the wild-type strain and retained the ability to cause pulmonary disease in neutropenic mice despite altered susceptibility to azoles

  • Species-Specific Pathogenicity:

    • Different species within section Fumigati show varying degrees of pathogenicity

    • A. lentulus, A. fumigatiaffinis, N. pseudofischeri, A. viridinutans, N. hiratsukae, and A. fumisynnematus have all been isolated from clinical samples, suggesting they can cause invasive infections in susceptible hosts

Clinical Implications:

Research has demonstrated that a number of different species whose morphological features resemble those of A. fumigatus can produce invasive infections in immunocompromised patients . The epidemiology and clinical relevance of these species, including their cytochrome b variations, require further investigation, particularly as some show high MICs for most available antifungals.

Importantly, mitochondrial function (which includes cytochrome b activity) plays a crucial role in cellular responses to environmental stresses, which may be particularly relevant in the context of host invasion. Future research should focus on:

  • Direct correlations between specific cytochrome b mutations and virulence in animal models

  • Effects of these mutations on fungal fitness in different host niches

  • Potential for targeting cytochrome b or related mitochondrial functions in antifungal therapy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.