Recombinant Neosartorya fumigata Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Neosartorya fumigata Formation of Crista Junctions Protein 1 (fcj1) is a protein expressed by the fungus Neosartorya fumigata, also known as Aspergillus fumigatus . The protein is tagged during the production process and stored in a Tris-based buffer with 50% glycerol .

Protein Information

Neosartorya fumigata Formation of Crista Junctions Protein 1 (fcj1) is also known as mitofilin and is a full length protein . The amino acid sequence is as follows :
ADAKPPVTGAPTPASPSSESSIPPETVPKPSPAAEAPLPPPPPPAPARKTGRFRKFLLYLILTSGFAYGGGIFLALKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNQNRAPKDEGHTVTIPSKSGLSWKVAEEESGADVSQKGPHMSALDNGDKAQLKPGAAKPEEKVATVEKVKAESAAKEQTAEDKKKVKEEPKKPAAPAVTPIEFATVSEGDEEVVQELVKTFNDIITVIGADENAHKFSGAVNKAKEELRTIGEKIIAIRNEARKAAQEEIKQAHATFDESARELIRRFEEARAHDAAQYREEFEAERERLARAYQEKVNTELQRAQEVAEQRLKNELVEQAIELNRKYLHEVKDLVEREREGRLSKLNELTANVNLLEKLTTDWKEVIDTNLKTQQLQVAVDAVRSVLERSTVPRPFVRELVAVKELAAGDPVVEAAIASINPTAYQRGIPSTSQIIERFRRVADEVRKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESVLLRTEHLLEEGNLDDAAREMNTLKGWAKILSKDWLSDVRRVLEVKQALEVRLGPFTSLFHLYR

  • Recommended Name: Formation of crista junctions protein 1

  • Alternative Name: Mitofilin

  • Gene Name: fcj1

  • ORF Name: AFUA_4G08030

  • Expression Region: 42-624

Function

This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processivity .

Neosartorya fischeri Antifungal Protein (NFAP)

NFAP and its peptide derivatives (PDs) have been tested for their antifungal properties against Cladosporium herbarum FSU 1148 . The positively charged γ NFAP-optGZ inhibited the germination of C. herbarum FSU 1148 conidia at the same minimum inhibitory concentration (MIC) as γ NFAP-opt (12.5 μg ml –1) . NFAP can induce morphological changes in the C. herbarum hyphae, resulting in a multi-branched phenotype when applied at concentrations below the MIC .

4.1. Effects of NFAP and γ-Core Peptide Derivatives on Cladosporium herbarum FSU 1148

TreatmentConcentration (μg/ml)Effect
NFAP12.5Induces severe morphological changes in hyphae, resulting in a multi-branched phenotype
γ NFAP-optChZ12.5Inactive; fungal growth visible, germlings resemble untreated control
γ NFAP-optGZ12.5Inhibits germination of C. herbarum FSU 1148 conidia
NFAPBelow MICInduces a dose-dependent response
γ NFAP-opt, γ NFAP-optGZBelow MICNo significant inhibitory effects on fungal growth

Role of GprM and GprJ in Cell Wall Maintenance and Immune Response

GprM and GprJ, G-protein coupled receptors in Aspergillus fumigatus, are important for the regulation of the cell wall integrity (CWI) pathway and secondary metabolite production . Deletion and overexpression of gprM and gprJ affect MpkA phosphorylation, which signals CWI pathway activation . Deletion of gprM and gprJ causes alterations in cell wall composition, which can influence the host immune response .

5.1. Impact on Macrophages

Macrophages contribute to innate immunity and fungal clearance during A. fumigatus infection . Conidia from the Δ gprJ and Δ gprM Δ gprJ strains are significantly more phagocytosed and killed than conidia from the wild-type and Δ gprJ::gprJ strains . The Δ gprM conidia are killed less than conidia from the wild-type and Δ gprM::gprM + strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mic60; AFUB_065130; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-624
Protein Length
Full Length of Mature Protein
Species
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Target Names
mic60
Target Protein Sequence
ADAKPPVTGAPTPASPSSESSIPPETVPKPSPAAEAPLPPPPPPAPARKTGRFRKFLLYL ILTSGFAYGGGIFLALKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNQNRAPK DEGHTVTIPSKSGLSWKVAEEESGADVSQKGPHMSALDNGDKAQLKPGAAKPEEKVATVE KVKAESAAKEQTAEDKKKVKEEPKKPAAPAVTPIEFATVSEGDEEVVQELVKTFNDIITV IGADENAHKFSGAVNKAKEELRTIGEKIIAIRNEARKAAQEEIKQAHATFDESARELIRR FEEARAHDAAQYREEFEAERERLARAYQEKVNTELQRAQEVAEQRLKNELVEQAIELNRK YLHEVKDLVEREREGRLSKLNELTANVNLLEKLTTDWKEVIDTNLKTQQLQVAVDAVRSV LERSTVPRPFVRELVAVKELAAGDPVVEAAIASINPTAYQRGIPSTSQIIERFRRVADEV RKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESVLLRTEHLLEEGNLDDAAREM NTLKGWAKILSKDWLSDVRRVLEVKQALEVRLGPFTSLFHLYR
Uniprot No.

Target Background

Function

Recombinant Neosartorya fumigata Formation of Crista Junctions Protein 1 (fcj1): A component of the mitochondrial inner membrane's MICOS complex, a large protein complex crucial for maintaining crista junctions, inner membrane architecture, and forming contact sites with the outer membrane. It plays a role in connecting cristae membranes to the inner boundary membrane and promotes protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Neosartorya fumigata Formation of crista junctions protein 1 (fcj1)?

Neosartorya fumigata Formation of crista junctions protein 1 (fcj1) is a mitochondrial protein expressed in Neosartorya fumigata (also known as Aspergillus fumigatus), a common pathogenic fungus that causes invasive aspergillosis. The protein is identified by UniProt accession number B0Y5Z6 and plays a crucial role in maintaining mitochondrial cristae structure and function . The protein consists of 624 amino acids with multiple functional domains responsible for its interaction with other mitochondrial proteins and membrane components. Fcj1 belongs to a family of proteins that are involved in the formation and maintenance of crista junctions, which are critical structures that connect the inner boundary membrane with cristae membranes in mitochondria.

The full amino acid sequence includes characteristic regions involved in protein-protein interactions and membrane association, with distinctive structural motifs that contribute to its function in mitochondrial morphology maintenance .

What are the optimal storage conditions for recombinant fcj1 protein?

For researchers working with recombinant fcj1 protein, appropriate storage is crucial to maintain protein stability and activity. The recommended storage conditions include keeping the protein at -20°C for routine storage, and at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for protein stability. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. For short-term experimental work, working aliquots can be maintained at 4°C for up to one week .

When preparing experimental aliquots, it's advisable to use small volumes to minimize freeze-thaw cycles and to centrifuge the protein solution briefly after thawing to collect any precipitated material before use in experimental procedures.

How is fcj1 characterized in Neosartorya fumigata compared to other fungal species?

Fcj1 in Neosartorya fumigata shares significant homology with similar proteins in other fungi, particularly within the Aspergillus genus. Comparative genomic analyses have revealed conserved domains across fungal species, suggesting evolutionary conservation of function. The protein contains characteristic regions involved in mitochondrial targeting and membrane association, which are preserved across fungal taxa.

The relationship between Neosartorya fumigata and other Aspergillus species has been studied using polyphasic approaches that combine morphological characteristics, molecular phylogenetics, and extrolite production profiles . Through such studies, researchers have been able to position fcj1 within the broader context of fungal evolution and adaptation.

What are the recommended protocols for working with recombinant fcj1 in laboratory settings?

When working with recombinant fcj1, researchers should implement the following methodological approaches:

  • Protein reconstitution: Recombinant fcj1 is typically supplied as a purified protein in a stabilizing buffer. Before experimental use, ensure the protein is completely thawed and gently mixed.

  • Functional assays: For assessing the membrane-binding properties of fcj1, liposome binding assays can be employed using artificial membrane systems that mimic the mitochondrial inner membrane composition.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity ligation assays can be used to identify fcj1 interaction partners within the mitochondrial network.

  • Structural studies: Circular dichroism spectroscopy can provide information about the secondary structure of fcj1, while nuclear magnetic resonance or X-ray crystallography can offer more detailed structural insights.

  • Cellular localization: Immunofluorescence microscopy using specific antibodies against fcj1 can confirm its mitochondrial localization in Neosartorya fumigata cells.

When designing experiments, it's essential to include appropriate controls, such as heat-denatured fcj1 or irrelevant proteins of similar size, to ensure the specificity of observed effects.

How can proteomic and transcriptomic approaches be applied to study fcj1 function?

Proteomic and transcriptomic analyses provide powerful tools for investigating fcj1 function in the context of cellular responses to various stimuli. Based on established protocols for Aspergillus fumigatus:

  • Sample preparation: Culture the fungus under appropriate conditions, such as in RPMI-1640 medium at 37°C for 24 hours. For stress response studies, treatment with compounds like amphotericin B (AMB) at MIC50 concentrations can be applied .

  • RNA extraction and transcriptomic analysis: Extract total RNA from fungal samples, treat with RNase-free DNase, and synthesize cDNA using a system like Super Script III first strand synthesis system. Design primers for fcj1 and related genes, and perform real-time RT-PCR using systems such as ABI 7900 HT Fast Real-Time PCR .

  • Protein extraction and proteomic analysis: For proteomics, extract proteins from fungal samples, separate them using 2D gel electrophoresis (in the pI range of 5-8 for optimal separation of mitochondrial proteins), and identify differentially expressed proteins using mass spectrometry techniques such as MALDI-TOF-MS .

  • Data analysis: Analyze transcriptomic data using appropriate statistical methods to identify differentially expressed genes. For proteomic data, use software like Global Proteomic Solutions (GPS) with the Mascot search engine to identify proteins, using parameters such as fixed modifications (Cys as S-carboamidomethyl derivative), variable modifications (oxidized methionine), and a mass tolerance of 50 ppm .

By correlating transcriptomic and proteomic data, researchers can gain comprehensive insights into how fcj1 expression and function are regulated in response to different environmental conditions or stressors.

How does fcj1 contribute to mitochondrial dynamics and fungal pathogenicity?

Fcj1's role in mitochondrial cristae formation positions it as a potentially important factor in fungal pathogenicity through several mechanisms:

  • Energy metabolism: Proper cristae architecture is essential for efficient oxidative phosphorylation. Changes in fcj1 expression or function may affect ATP production, influencing the fungus's ability to proliferate in host tissues.

  • Stress response: Mitochondria play crucial roles in cellular responses to various stresses. The transcriptomic and proteomic analyses of Aspergillus fumigatus under stress conditions have revealed significant remodeling of mitochondrial proteins, suggesting that proteins like fcj1 may be involved in adaptation to host defense mechanisms .

  • Apoptosis regulation: Cristae remodeling is a key event in apoptotic pathways. Fcj1's involvement in maintaining cristae structure may influence the fungus's susceptibility to host-induced cell death signals.

Research methodologies to investigate these aspects include:

  • Generating fcj1 knockout or knockdown strains to assess changes in mitochondrial morphology and function

  • Infection models using modified strains to evaluate virulence in vivo

  • Comparative proteomics of wild-type versus fcj1-deficient strains under host-mimicking stress conditions

What are the implications of fcj1 in antifungal drug resistance mechanisms?

The relationship between mitochondrial function and antifungal resistance presents an important area for investigation. Studies on Aspergillus fumigatus response to antifungal agents have revealed that multiple cellular processes are affected, including ergosterol biosynthesis, cell stress responses, cell wall maintenance, and transport proteins .

Potential mechanisms by which fcj1 might influence drug resistance include:

  • Metabolic adaptation: Alterations in mitochondrial function could provide metabolic flexibility that helps the fungus survive in the presence of antifungals.

  • Stress response pathways: Mitochondrial proteins, including those involved in cristae maintenance, may participate in cellular stress responses that confer resistance.

  • Membrane composition: Cristae architecture influences membrane properties, potentially affecting the interaction of antifungal drugs with their targets.

Experimental approaches to study these connections include:

  • Comparative expression analysis of fcj1 in drug-sensitive versus resistant strains

  • Assessment of antifungal susceptibility in fcj1-modified strains

  • Lipidomic analysis to evaluate membrane composition changes associated with fcj1 expression levels

What analytical techniques are most effective for studying fcj1 interactions with other mitochondrial proteins?

To comprehensively investigate fcj1 interactions within the mitochondrial proteome, researchers should consider the following analytical approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): This technique can identify proteins that physically interact with fcj1. By using tagged recombinant fcj1 as bait, researchers can pull down interacting proteins and identify them through mass spectrometry.

  • Proximity-dependent biotin identification (BioID): This approach involves fusing fcj1 with a biotin ligase that biotinylates nearby proteins, allowing for the identification of proteins in close proximity to fcj1 in the native cellular environment.

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linking can capture transient interactions between fcj1 and other proteins, which can then be identified through mass spectrometry.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique can preserve protein complexes containing fcj1 and separate them based on size, allowing for the identification of specific protein complexes involving fcj1.

  • Förster resonance energy transfer (FRET): By tagging fcj1 and potential interaction partners with appropriate fluorophores, researchers can detect interactions based on energy transfer between the fluorophores.

For data analysis, researchers should employ comprehensive bioinformatics approaches, including protein interaction network analysis and functional enrichment analysis to contextualize fcj1 interactions within broader cellular processes.

What are the primary technical challenges in studying fcj1 function in Neosartorya fumigata?

Researchers face several significant challenges when investigating fcj1 function:

  • Genetic manipulation: Efficient genetic transformation systems for Neosartorya fumigata require optimization. Current protocols for strain Af293 provide a foundation, but targeted modifications of fcj1 may require refined approaches .

  • Protein purification: The hydrophobic nature of membrane-associated proteins like fcj1 presents challenges for purification and structural studies. Optimization of detergent conditions is critical for maintaining protein stability and native conformation.

  • In vivo imaging: Visualizing mitochondrial dynamics in living fungal cells requires specialized microscopy techniques that can penetrate the fungal cell wall while maintaining sufficient resolution to observe cristae structures.

  • Physiological relevance: Correlating in vitro observations with in vivo function requires careful experimental design to mimic relevant physiological conditions. Studies have shown that culture conditions significantly affect fungal gene expression and protein profiles .

  • Functional redundancy: Potential compensatory mechanisms may mask phenotypes in fcj1-deficient strains, necessitating combinatorial approaches targeting multiple related proteins.

How might fcj1 research contribute to novel antifungal development strategies?

Understanding fcj1 function opens several avenues for antifungal drug development:

  • Target validation: If fcj1 is essential for fungal viability or virulence, it may represent a novel drug target. Approaches to validate fcj1 as a target include conditional knockdown studies and chemical genetics screens.

  • Combination therapies: Targeting fcj1 or related mitochondrial functions may enhance the efficacy of existing antifungals like amphotericin B, which has been shown to affect multiple cellular processes in Aspergillus fumigatus .

  • Selective targeting: Structural differences between fungal fcj1 and human homologs could be exploited to design selective inhibitors. Comparative structural analysis and molecular docking studies can identify potential binding sites unique to the fungal protein.

  • Biomarker development: Expression patterns of fcj1 under different conditions might serve as biomarkers for fungal responses to environmental stresses or antifungal treatments, potentially guiding therapeutic decisions.

Research methodologies to explore these possibilities include high-throughput screening of chemical libraries against recombinant fcj1, structure-based drug design, and phenotypic screening of fcj1-modulated fungal strains against candidate compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.