Recombinant Neosartorya fumigata GPI mannosyltransferase 3 (gpi10)

Shipped with Ice Packs
In Stock

Description

Functional Role in Fungal Biology

GPI mannosyltransferase 3 catalyzes the addition of mannose residues during GPI anchor assembly, which anchors proteins to the cell membrane. Key findings include:

  • Cell Wall Integrity: GPI-anchored proteins are critical for fungal cell wall structure. Disruption of gpi10 homologs in Aspergillus fumigatus leads to cell lysis, abnormal hyphal growth, and defective conidiation .

  • Virulence: gpi10 deletion mutants in A. fumigatus exhibit attenuated virulence in immunocompromised mice, highlighting its role in pathogenicity .

  • Immune Evasion: GPI-anchored surface proteins like CcpA in A. fumigatus modulate host immune responses by altering conidial surface recognition .

Recombinant Production and Applications

Expression Systems

  • Hosts: Flexible production in E. coli, yeast, or mammalian cells .

  • Yield: High-purity (>85%) protein suitable for structural studies and enzymatic assays .

Research Applications

  • Enzymatic Studies: Used to characterize mannosyltransferase activity in GPI biosynthesis .

  • Drug Development: Target for antifungals disrupting GPI anchor synthesis, a pathway absent in humans .

  • Comparative Genomics: Homology studies across fungi (e.g., Aspergillus oryzae, Saccharomyces cerevisiae) reveal evolutionary conservation .

Related Recombinant Proteins

SpeciesGene IDProtein LengthHost System
Gibberella zeaeFGSG_05545PartialE. coli/Yeast
Candida glabrataCAGL0F07843gPartialMammalian Cells
Saccharomyces cerevisiaeGPI10PartialBaculovirus

Data sourced from MyBioSource and Creative BioMart .

Research Implications

Studies on recombinant GPI10 have clarified its role in fungal pathogenesis and cell wall dynamics. For example:

  • Virulence Attenuation: A. fumigatus Δgpi10 mutants show reduced survival in murine models, suggesting GPI anchors as therapeutic targets .

  • Immune Modulation: Recombinant GPI-anchored proteins alter dendritic cell maturation and cytokine responses, implicating immune evasion mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
gpi10; AFUA_4G09130; GPI mannosyltransferase 3; GPI mannosyltransferase III; GPI-MT-III; Glycosylphosphatidylinositol-anchor biosynthesis protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-771
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
gpi10
Target Protein Sequence
MSSSRRRKSFTSSSSSSSPSFHSPPPTSRLRPRSPPSSNTKTSPTSTTPLATNILLSLIA FRLVNAFTVRTFFQPDEFFQSLEPAWQIAFGENQGAWITWEWRHQLRSSIHPLLFAAVYS AADVVAQLLRLSLASRADLLVAAPKTAQAVIAGLGDFYTWKLARYVYGARSYEAWATLAL TVVSPWQWFCSTRTLSNCLETTITIVALYLWPWSWSFETPVRKKATRAASRERAQRGPEG SDSLQRLRQCLSLAAVACILRPTNILIWMGLASVAWFRTSWDRRAILVREVLLCGCAVLG LSCVVDRLFYGSWTFPPLRFLYFNIAQSLAVFYGRNDWHYYVSQGFPLLLTTALPFALVG LYRALAQVRTFGLGHLQSLVQAQLALICVIMPFVLSLVSHKEVRFIYPLLPSLHILSAPP LVDYFLPAVIRSSRSYTPRRLTLIFLLLVNIVIALYTTIYHASGPSNILSYLRQQHELHA PAAQTPSNLRPSVKDPSPHGITAGFLMPCHSTPWRSHLIYPTIHAWALTCEPPVDQTAAQ KATYIDEADQFYANPARFLREHMAGGLRHISRKPSYLSAQPRPQHPSTTSTNDASHEWPD YLIFFAQLEPTLQSLLRASSYAECYRTFNTAWHDDWRRKGDIVAWCLDPAEQQAWRSATR QRDLENRERQFDRIIESFRKEASGKRDGKLSPFRRWFSSSSSVAPSSSLSLSWPTSWRWP WGQRKRTAWLGVQIPQWTRTRPSWTAWGGDWFGGWRQKKKTKKLLERDLWS
Uniprot No.

Target Background

Function
Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the third mannose to Man2-GlcN-acyl-PI during GPI precursor assembly.
Database Links
Protein Families
Glycosyltransferase 22 family, PIGB subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.