Recombinant Neosartorya fumigata High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Sho1 is a full-length, His-tagged protein expressed in E. coli and derived from Neosartorya fumigata (the teleomorph of Aspergillus fumigatus) . It is a transmembrane sensor protein involved in the High Osmolarity Glycerol (HOG) mitogen-activated protein kinase (MAPK) pathway, which enables fungi to adapt to osmotic and oxidative stress . The protein features four transmembrane domains and a C-terminal Src Homology 3 (SH3) domain, facilitating interactions with downstream signaling components like Pbs2 MAPK .

Biochemical and Biophysical Properties

Key characteristics of recombinant Sho1 include:

PropertyDetails
UniProt IDQ4WUG9
Amino Acid Sequence288 residues, including a signal peptide and conserved cysteine residues
Molecular Weight~33 kDa (calculated)
Expression SystemE. coli
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer

Role in Stress Adaptation

Sho1 regulates fungal responses to environmental stressors:

  • Oxidative Stress: A. fumigatus Δsho1 mutants show hypersensitivity to hydrogen peroxide (2.5 mM) and menadione (15 μM), indicating impaired redox homeostasis .

  • Morphogenesis: Deletion of sho1 disrupts hyphal elongation, phialide formation, and conidiation, leading to hyperbranched, stunted hyphae .

Phenotypic Analysis of Δsho1 Mutants

ParameterWild-TypeΔsho1 MutantComplemented Strain
Radial Growth RateNormalReduced by 40%Restored
Germination DelayNone2–4 hoursRestored
Hyphal MorphologyRegularHyperbranchedRestored
Oxidative Stress SensitivityLowHighRestored

Source: In vitro studies using A. fumigatus models .

Pathogenic Implications

Despite its role in stress adaptation, Δsho1 mutants retained full virulence in immunocompromised murine models, suggesting compensatory pathways in A. fumigatus pathogenesis .

Applications and Relevance

  • Biotechnological Use: Recombinant Sho1 serves as a tool for studying fungal stress signaling and HOG pathway mechanics .

  • Therapeutic Targets: Sho1 homologs in pathogenic fungi (e.g., Candida albicans) are explored for antifungal drug development .

Homology and Cross-Species Conservation

Sho1 is conserved across fungi, with 71–83% sequence identity to Saccharomyces cerevisiae and Aspergillus nidulans homologs . In N. fumigata, its function aligns with A. fumigatus, underscoring evolutionary conservation in stress response mechanisms .

Limitations and Future Directions

  • The lack of virulence attenuation in Δsho1 mutants warrants investigation into redundant signaling pathways .

  • Structural studies of Sho1-Pbs2 interactions could inform inhibitor design against fungal pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sho1; AFUB_055960; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Target Names
sho1
Target Protein Sequence
MAKFRASNILGDPFALATVSISILAWLIACIASIISDIKTDYPNYSWWAVAYMFCCIMGV TIVFGSDTGLVYGVAVVGYLSTGLVLTTLAVNSLVYADESSSQAAAAGFILMSMVIVVWI FYFGSSPQATHRGFIDSFALNKESSGAYGNRPMSTAYGPRPDTMSTSAPQMYTSAQLNGF ETSSPVSGYPGGGPGSENRSSSQARFGNPSASNVAGNNSGQDEVPPPTEYPYKAKAIYSY DANPEDANEISFSKHEILEVSDVSGRWWQARKSNGETGIAPSNYLILL
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity. Regulates radial hyphal growth and germination. Involved in virulence and mediates resistance to oxidative stress.
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.