The recombinant Neosartorya fumigata mitochondrial import inner membrane translocase subunit TIM21 (tim21) is a bioengineered protein derived from Aspergillus fumigatus strain ATCC MYA-4609 (Af293). This protein functions as a critical component of the TIM23 complex, mediating the import of mitochondrial matrix-targeting preproteins. Key characteristics include:
TIM21 contains a single transmembrane domain and an intermembrane space (IMS)-exposed domain critical for interactions. The recombinant protein spans amino acids 36–237, with a sequence including conserved motifs for translocase assembly and protein binding .
| Domain | Function |
|---|---|
| Transmembrane | Anchors TIM21 to the inner mitochondrial membrane |
| IMS Domain | Binds to TIM50 (presequence receptor) and Tom22 (TOM complex receptor) |
TIM21 bridges the TOM and TIM23 complexes, enabling efficient translocation of presequence-containing proteins. Key mechanisms include:
Signal Recognition: Presequence docking triggers TIM21 dissociation from TIM50, enabling Pam17 recruitment and translocase activation .
Electrostatic Interactions: The IMS domain of TIM21 binds negatively charged residues in Tom22 (e.g., Asp131, Asp135) via conserved positively charged patches .
Respiratory Complex Assembly: TIM21 shuttles between translocase and assembly intermediates, facilitating integration of nuclear-encoded subunits into complexes I and IV .
Interaction Studies: Validate binding to TIM50, Tom22, or Pam17 using co-IP or crosslinking assays .
ELISA Assays: Detect TIM21-specific antibodies or interactions in mitochondrial import models .
Structural Analysis: Crystallization or NMR studies to resolve TIM21’s α/β-fold and binding interfaces .
TIM21 dynamics during import:
Presequence Recognition: Presequence peptides (e.g., pCox4) inhibit TIM21-Tom22 interactions, triggering TIM21 release from TIM50 .
Motor Recruitment: Pam17 binds to TIM23 after TIM21 dissociation, forming the motor-associated translocase (TIM23 MOTOR) .
While Neosartorya fumigata TIM21 is not directly linked to human diseases, its homolog TIMM21 in humans is associated with:
Optic Atrophy 12: Impaired mitochondrial protein import leading to retinal degeneration .
Complex I/IV Deficiency: Disrupted assembly of respiratory complexes .
Recombinant Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim21 (tim21) is an essential component of the TIM23 complex, which facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Its role is crucial in maintaining close proximity between the TOM and TIM23 complexes. Following its participation in this initial complex formation, tim21 is released to enable subsequent protein translocation into the mitochondrial matrix.
KEGG: afm:AFUA_2G09820
STRING: 5085.CADAFUBP00002508
Tim21 is a subunit of the presequence translocase of the inner mitochondrial membrane (the TIM23 complex) that consists of a membrane anchor and a carboxy-terminal domain exposed to the intermembrane space . Its primary function is to directly connect the translocase of the outer membrane (TOM complex) and the TIM23 complex by binding to the intermembrane space domain of the Tom22 receptor . This connection is crucial for efficient protein import into mitochondria.
In Neosartorya fumigata (now commonly classified as Aspergillus fumigatus), Tim21 is encoded by the gene AFUA_2G09820 . The mature Tim21 protein spans amino acid residues 36-237 and functions within the sophisticated machinery that facilitates protein import across mitochondrial membranes . This process is essential for mitochondrial biogenesis and function, making Tim21 vital for fungal cellular metabolism and energy production.
The binding domain of Tim21 represents a novel α/β-mixed protein fold consisting of two α-helices flanked by an extended eight-stranded β-sheet . This unique structural arrangement enables its specific interaction with Tom22 and positions Tim21 as the first structurally characterized component of the mitochondrial presequence translocase .
Neosartorya fumigata (Aspergillus fumigatus) Tim21 shares phylogenetic similarities with other fungal species, but contains species-specific sequences that can be leveraged for identification purposes . The anamorphs of Neosartorya species are phylogenetically and morphologically very close to Aspergillus fumigatus, making differentiation important in both research and diagnostic settings .
Molecular studies examining β-tubulin and calmodulin genes have identified regions that allow for specific detection and differentiation between Neosartorya species and A. fumigatus . These distinctions are particularly important when studying mitochondrial protein import machinery across fungal species, as subtle structural variations in Tim21 may reflect evolutionary adaptations to different ecological niches.
While the core function of Tim21 in mitochondrial protein import is conserved, species-specific variations in its sequence and structure may influence its interaction with other components of the import machinery. These differences may contribute to the varying metabolic capabilities, stress responses, and pathogenicity observed among different fungal species.
The recombinant Neosartorya fumigata Tim21 protein consists of 202 amino acids (residues 36-237 of the mature protein) with the following amino acid sequence: ATQSDLGGGSGSKATPRRRNVTVLSDDGRYEWGELSGREKVARATQQSLNFLVIVAGAVLTGGVFYLLYTEVFSPNSRTWQFEKAVQRIKDDPRCTDLLGDRREIKAYGESTGSRWERNRPIATSMFKDRQGREHMKMHFHVEGPLNSGIVIVHMMKPLDKDEWEYLLLALDVKGHSRVILEQAQEKPGVAKALKIFGIQWR .
The crystal structure of Tim21's binding domain, determined at 1.6 Å resolution, reveals a novel protein fold with a mixed α/β structure . The surface of Tim21 displays patches of conserved, positively charged residues that interact with the negatively charged intermembrane space domain of Tom22 . This electrostatic interaction is crucial for Tim21's function in connecting the TOM and TIM complexes.
When expressed recombinantly, Tim21 is often tagged with epitopes such as His-tag to facilitate purification and detection . The full-length recombinant protein maintains its functional domains, including the binding interface that mediates its interaction with Tom22.
Escherichia coli represents the preferred expression system for recombinant Neosartorya fumigata Tim21 production . This bacterial expression system offers several advantages for Tim21 expression, including high yield, scalability, and cost-effectiveness. When expressing Tim21 in E. coli, researchers typically fuse the protein with tags such as His-tag or SUMO to enhance solubility and facilitate purification .
For optimal expression, the coding sequence for the mature Tim21 protein (amino acids 36-237) is generally used, as this represents the functional domain without the mitochondrial targeting sequence . The expression construct should be designed with appropriate restriction sites and optimized codon usage for E. coli to maximize protein yield.
Induction conditions should be carefully optimized, typically using IPTG at concentrations between 0.1-1.0 mM, with induction temperatures around 18-25°C to minimize inclusion body formation. Expression at lower temperatures (16-18°C) overnight often results in higher yields of properly folded protein compared to shorter incubations at higher temperatures.
Purification of recombinant His-tagged Tim21 typically employs immobilized metal affinity chromatography (IMAC) as the initial capture step . The procedure should begin with cell lysis under native conditions, using a buffer containing 20-50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, and 10-20 mM imidazole, supplemented with protease inhibitors.
Following IMAC purification, size exclusion chromatography is recommended to remove aggregates and ensure monodispersity of the Tim21 preparation. For structural studies or binding assays, an additional ion exchange chromatography step may be beneficial to remove contaminants with similar molecular weights.
The purified Tim21 protein should be stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability . For long-term storage, addition of 5-50% glycerol (with 50% being optimal) followed by aliquoting and storage at -20°C/-80°C is recommended . Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity.
To verify the structural integrity of purified Tim21, multiple complementary approaches should be employed:
SDS-PAGE and Western blotting: Assess purity (should exceed 90%) and confirm the expected molecular weight of the recombinant protein .
Circular Dichroism (CD) Spectroscopy: Analyze the secondary structure content to confirm the characteristic α/β-mixed fold of Tim21.
Dynamic Light Scattering (DLS): Verify the monodispersity of the protein preparation and detect potential aggregation.
Thermal Shift Assay: Determine the thermal stability of the purified protein, which can indicate proper folding.
Functional Binding Assays: Confirm the ability of Tim21 to bind its interaction partner Tom22, using techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or pull-down assays with recombinant Tom22 intermembrane space domain.
For structural studies, X-ray crystallography has been successfully employed to determine the three-dimensional structure of Tim21 at high resolution (1.6 Å) . This approach provides detailed insights into the unique fold of Tim21 and the structural basis for its interaction with Tom22.
Tim21 plays a crucial role in connecting the protein translocases of the outer and inner mitochondrial membranes through a direct interaction with the Tom22 receptor . This interaction is primarily mediated by electrostatic forces between positively charged patches on the surface of Tim21 and negatively charged residues in the intermembrane space domain of Tom22 .
Research has identified a core 17-residue segment of Tom22's intermembrane space domain that is sufficient for binding to Tim21 . Within this segment, two negatively charged residues are particularly important for the association with Tim21 . This electrostatic interaction explains the observation that positively charged presequences compete with Tim21 for binding to Tom22 .
The Tim21-Tom22 interaction represents a dynamic coupling between the TOM and TIM23 complexes rather than a permanent association. This allows for regulated protein translocation across both mitochondrial membranes in response to cellular needs. Researchers investigating this interaction should consider employing techniques such as site-directed mutagenesis to modify charged residues, followed by binding assays to quantify interaction strength under various conditions.
While direct evidence linking Tim21 to fungal pathogenicity is limited in the provided search results, the protein's essential role in mitochondrial function suggests potential implications for virulence. Mitochondrial function is critical for fungal adaptation to host environments, stress responses, and metabolic flexibility during infection.
Aspergillus fumigatus (Neosartorya fumigata) is an opportunistic pathogen that causes severe infections in immunocompromised individuals . The ability to detect and diagnose these infections is crucial for patient management . Research into fungal-specific proteins like Tim21 could potentially identify novel targets for antifungal development or diagnostic applications.
The close phylogenetic relationship between pathogenic and non-pathogenic Neosartorya species necessitates precise identification methods . PCR-based approaches targeting species-specific regions of genes, similar to those developed for β-tubulin and calmodulin, could potentially be applied to Tim21 for rapid identification of pathogenic fungi .
Future research directions might explore whether Tim21's function is modulated during infection or stress conditions, and whether disruption of Tim21 function impacts fungal virulence in animal models of aspergillosis.
While Tim21 itself is not currently described as a diagnostic target in the provided search results, the principles of fungal protein detection have significant diagnostic applications. Researchers have developed methods to detect Aspergillus fumigata infections using:
Radioactive imaging techniques: A new method using radiolabeled cellobiose ([18F]-Fluorocellobiose) enables non-invasive detection of Aspergillus infections through PET scanning . This approach leverages the fungal-specific ability to metabolize cellobiose.
Recombinant antigen-based immunoassays: IgE against recombinant Aspergillus fumigata antigens, particularly rAsp f1 and rAsp f2, has demonstrated high sensitivity and specificity in diagnosing allergic bronchopulmonary aspergillosis (ABPA) . Receiver-operating characteristic-derived cutoffs for rAsp f1 (4.465 kU A/L) and f2 (1.300 kU A/L) provide 100% sensitivity and 81% specificity .
PCR-based molecular identification: Methods have been developed to differentiate between Neosartorya species and Aspergillus fumigatus using specific primer sets targeting β-tubulin and calmodulin genes . Similar approaches could potentially be developed for Tim21.
Similar principles could be applied to develop Tim21-based diagnostic approaches, particularly if unique epitopes or sequences specific to pathogenic fungal species are identified within the Tim21 protein.
Working with recombinant Tim21 presents several challenges that researchers should anticipate and address:
Protein solubility issues: Tim21 contains both hydrophilic and hydrophobic regions, which may affect solubility during expression and purification. Using solubility-enhancing tags like SUMO or optimizing buffer conditions can help overcome this challenge .
Proper folding: As a protein with a distinct α/β-mixed fold, Tim21 requires proper folding to maintain its functional properties. Expression at lower temperatures (16-18°C) and inclusion of folding enhancers such as trehalose in storage buffers can promote correct folding .
Stability during storage: Tim21 preparations may lose activity during storage due to aggregation or degradation. Adding stabilizers such as trehalose (6%) and glycerol (5-50%) to storage buffers can help maintain protein integrity .
Batch-to-batch variability: Expression and purification conditions need to be carefully standardized to ensure consistent protein quality across different preparations. Implementing rigorous quality control steps, including SDS-PAGE, Western blotting, and functional assays, is essential.
Maintaining native conformation: For functional studies, preserving the native conformation of Tim21 is crucial. Avoiding harsh conditions during purification and minimizing freeze-thaw cycles (storing working aliquots at 4°C for up to one week) can help maintain native structure .
To optimize binding assays investigating Tim21 interactions with Tom22 or other partners:
Buffer optimization: The Tim21-Tom22 interaction involves electrostatic forces, so buffer ionic strength and pH significantly impact binding . A starting buffer containing 20 mM HEPES or Tris-HCl (pH 7.2-7.4) with 50-150 mM NaCl is recommended, with systematic variation to determine optimal conditions.
Protein concentration: Titrating protein concentrations is essential to identify the linear range for binding assays. For pull-down or co-immunoprecipitation assays, start with equimolar concentrations of Tim21 and its binding partner (typically 0.1-1 μM).
Detection methods: For quantitative binding studies, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides robust kinetic and thermodynamic parameters. For qualitative confirmation of interactions, pull-down assays followed by Western blotting are more accessible.
Controls: Include negative controls (mutated versions of Tim21 or Tom22 lacking critical binding residues) and positive controls (well-characterized protein-protein interactions with similar binding properties) in all assays.
Competition assays: Since positively charged presequences compete with Tim21 for binding to Tom22 , including synthetic presequence peptides at varying concentrations can provide insights into binding mechanisms and confirm specificity.
Implementing rigorous quality control measures is essential for reliable Tim21 research:
Purity assessment: SDS-PAGE analysis should confirm >90% purity of recombinant Tim21 preparations . Densitometry analysis of Coomassie-stained gels can provide quantitative purity metrics.
Identity confirmation: Mass spectrometry (MS) analysis, particularly peptide mass fingerprinting or LC-MS/MS, should verify the identity of the purified protein by matching observed peptides to the expected Tim21 sequence.
Structural integrity: Circular dichroism (CD) spectroscopy can confirm the expected secondary structure content, while thermal shift assays can assess protein stability and proper folding.
Functional validation: Binding assays with recombinant Tom22 intermembrane space domain should demonstrate specific interaction with expected affinity, confirming that the purified Tim21 is functionally active.
Batch documentation: Maintaining detailed records of expression conditions, purification protocols, and quality control results for each protein preparation facilitates troubleshooting and ensures reproducibility.
Storage stability monitoring: Regular testing of stored protein samples over time (e.g., at 0, 1, 3, 6 months) can establish the shelf-life under various storage conditions and guide optimal usage timeframes.
Tim21 research offers several promising avenues for advancing our understanding of fungal mitochondrial biology:
Comparative structural studies: Extending the structural analysis of Tim21 from Saccharomyces cerevisiae to Neosartorya fumigata and other pathogenic fungi would reveal species-specific features that might correlate with metabolic adaptations or pathogenicity.
Dynamic regulation: Investigating how Tim21-mediated TOM-TIM interactions are regulated under different metabolic conditions or stress responses could provide insights into mitochondrial adaptation mechanisms in fungi.
Protein import kinetics: Developing real-time assays to monitor protein import kinetics in the presence and absence of functional Tim21 would enhance our understanding of the precise role of this protein in coordinating translocase activities.
Interaction network mapping: Comprehensive mapping of the Tim21 interaction network beyond Tom22 might reveal additional partners that influence mitochondrial function in fungi.
In vivo function: Creating conditional Tim21 mutants in Neosartorya fumigata and analyzing their phenotypes under various growth conditions could elucidate the protein's role in fungal physiology and potentially pathogenicity.
The essential role of Tim21 in mitochondrial protein import suggests potential as a target for antifungal development, though this application is not directly addressed in the provided search results. Several considerations support this potential:
Fungal specificity: If structural or sequence differences between fungal and human Tim21 orthologs can be identified, these could be exploited to develop selectively toxic compounds.
Essential function: Disruption of mitochondrial protein import would likely have severe consequences for fungal viability, particularly under the stress conditions encountered during host infection.
Surface accessibility: The intermembrane space domain of Tim21 that mediates Tom22 binding presents a potentially accessible site for small molecule inhibitors that could disrupt this critical interaction.
Established precedent: Other components of essential fungal cellular machinery have been successfully targeted by antifungal drugs, suggesting a similar approach might be viable for components of the mitochondrial import machinery.
A research pipeline for exploring Tim21 as an antifungal target would involve: (1) comparative structural analysis of fungal versus human Tim21, (2) development of high-throughput screening assays for Tim21-Tom22 interaction inhibitors, (3) structure-based design of potential inhibitors, and (4) evaluation of candidate compounds in fungal growth and infection models.
Recent advances in imaging methodology offer exciting opportunities for Tim21 research:
Super-resolution microscopy: Techniques such as STED, PALM, or STORM could visualize the spatial organization of Tim21 within mitochondrial membranes at nanometer resolution, providing insights into its distribution and dynamics during protein import.
Live-cell imaging: Tagging Tim21 with fluorescent proteins compatible with live-cell imaging would allow monitoring its dynamics during different cellular states or in response to stressors.
Correlative light and electron microscopy (CLEM): This approach could connect the molecular-level organization of Tim21 with the ultrastructural features of mitochondria in various fungal species or under different conditions.
PET imaging for in vivo fungal detection: The development of radiolabeled tracers like [18F]-Fluorocellobiose for fungal detection in vivo provides a model for how imaging approaches can be applied to study fungal proteins in living organisms. Similar approaches could potentially be developed to study mitochondrial function in intact fungi.
Cryo-electron tomography: This technique could visualize the native arrangement of TOM and TIM complexes within mitochondrial membranes, providing insights into how Tim21 physically bridges these complexes in situ.
Advanced imaging approaches would complement biochemical and structural studies of Tim21, providing a more comprehensive understanding of its function in the context of the intact mitochondrion and whole fungal cell.