Recombinant Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim50 (tim50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance if dry ice is required.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.
Tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
tim50; AFUA_2G03420; Mitochondrial import inner membrane translocase subunit tim50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-501
Protein Length
Full Length of Mature Protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
tim50
Target Protein Sequence
AKSSKPKAPYKLPESVKPPQSEQPSSTPKPEYSAEQTEFDTKADPAGNAAPEASEATESK PQQPLPDLTQGIPSTLAAELEGRTKKSGQTSLNLTEDPSRFEDYTDDGRGDIPKDGYVSS LDRRRARMANLMYAFFLLAGAGGVAYLGRNWETEEEAKAHPDIPSGWSFSSWYNRMKARL SDITSYYKDPAFPKLLPDEDPNLRQPYTLVLSLEDLLVHSEWSREHGWRIAKRPGVDYFL RYLNQYYELVLFTSVPSMMADQVLRKLDPYRIIRWPLFREATRYKDGEYIKDLSYLNRDL SKVILIDTKEEHARLQPENAIILDKWLGDPKDKNLVALIPFLEYIAGMGVEDVRPVLKSF EGTSIPVEFAKRERIMREKFEKELEEERKRRPKRGVGSLASALGLKSTRTLDGEQSPSEG LAQGKMLWDQIRERGQKNYEMIEKEIRENGEKWLAEMAAEEEKARQEQMKMMKGSFTSMF GAGKQ
Uniprot No.

Target Background

Function

Recombinant Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim50 (tim50) is an essential component of the TIM23 complex. This complex mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Tim50 is required to direct preproteins during transit to the channel protein TIM23. It may also facilitate the transfer of translocating proteins from the TOM complex to the TIM23 complex.

Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Tim50 and what is its role in mitochondrial protein import?

Tim50 is an essential component of the TIM23 preprotein translocase complex located in the inner membrane of mitochondria. It serves as a primary receptor for preproteins entering the intermembrane space and facilitates their transfer from the translocase of the outer membrane (TOM complex) to the TIM23 complex. Research on Neurospora crassa has shown that Tim50 spans the inner membrane with a single transmembrane segment and exposes a large hydrophilic domain in the intermembrane space, which interacts with incoming preproteins .

This protein plays a crucial role in the import of approximately 60% of the mitochondrial proteome. Studies have demonstrated that mitochondria depleted of Tim50 display significantly reduced import kinetics of preproteins using the TIM23 complex . Cross-linking experiments have confirmed that Tim50 interacts with preproteins that are halted at the level of the TOM complex or spanning both TOM and TIM23 complexes, suggesting its importance in guiding proteins through the intermembrane space .

How are Neosartorya species related to Aspergillus fumigatus?

Neosartorya species are phylogenetically and morphologically very close to Aspergillus fumigatus. In fact, Neosartorya represents the teleomorphic (sexual) state of certain Aspergillus species, with their anamorphs (asexual forms) being classified within the Aspergillus genus . This taxonomic relationship creates challenges in species identification and classification in research settings.

Notably, while Aspergillus fumigatus has never been reported as a spoilage agent in heat-processed food products, Neosartorya species are known to cause spoilage in heat-processed acidic foods due to their formation of heat-resistant ascospores . The close relationship yet distinct characteristics necessitate precise identification methods, such as PCR-based approaches targeting β-tubulin and calmodulin genes, to differentiate between these species .

What are the key biological differences between Neosartorya species and Aspergillus fumigatus?

Despite their close phylogenetic relationship, Neosartorya species and Aspergillus fumigatus exhibit several important biological differences:

  • Thermotolerance: While A. fumigatus can grow at temperatures up to 55°C but not at 10°C, Neosartorya udagawae (a representative Neosartorya species) can grow at 10°C but fails to grow at temperatures above 42°C .

  • Growth characteristics: Neosartorya species generally require longer incubation periods for conidia to germinate at 37°C compared to A. fumigatus .

  • Susceptibility to host defenses: The conidia of N. udagawae have been shown to be more susceptible to neutrophil attack and hydrogen peroxide compared to A. fumigatus .

  • Virulence: Studies in mouse models have demonstrated that N. udagawae is less virulent than A. fumigatus .

  • Clinical manifestations: Infections caused by Neosartorya species often show distinctive patterns of disease progression compared to those caused by A. fumigatus, typically with a longer duration of illness and higher resistance to standard antifungal therapies .

What techniques can be used to study Tim50's interactions with preproteins during mitochondrial import?

Several sophisticated techniques can be employed to investigate the interactions between Tim50 and preproteins:

  • Chemical cross-linking: This approach has been successfully used to capture the transient interactions between Tim50 and preproteins. For example, researchers have used the cross-linker DFDNB at a concentration of 200 μM to identify interactions between Tim50 and preproteins halted at different stages of import . The cross-linking reaction is typically performed for 30 minutes on ice and then quenched with glycine before analysis by immunoprecipitation and SDS-PAGE.

  • Preprotein arrest assays: By using strategies to arrest preproteins at specific stages of import (such as removing membrane potential with uncouplers like CCCP or using folded DHFR domains to block complete translocation), researchers can study how Tim50 interacts with preproteins at distinct steps in the import pathway .

  • Chase experiments: Time-course experiments where preprotein import is synchronized (for example, by first depleting membrane potential and then restoring it) allow for tracking the kinetics of Tim50-preprotein interactions .

  • Immunoprecipitation with antibodies against the N-terminal peptide of Tim50 can be used to isolate Tim50-preprotein complexes following cross-linking .

How can recombinant Tim50 from Neosartorya species be expressed and purified for structural and functional studies?

While the search results don't specifically address expression of recombinant Tim50 from Neosartorya species, general approaches for mitochondrial membrane proteins can be adapted:

  • Expression systems: E. coli, yeast (Saccharomyces cerevisiae or Pichia pastoris), or insect cell expression systems can be used, with codon optimization for the selected expression host.

  • Fusion tags: Addition of affinity tags (His6, GST, MBP) can facilitate purification while potentially enhancing solubility. Inclusion of protease cleavage sites allows for tag removal post-purification.

  • Membrane protein considerations: Since Tim50 contains a transmembrane domain, expression strategies may need to address the challenges of membrane protein production, such as inclusion of detergents or lipids during extraction and purification.

  • Functional verification: Activity assays measuring the ability of purified Tim50 to bind preproteins or interact with other TIM23 complex components can confirm proper folding and function of the recombinant protein.

What is the impact of TIMM50/Tim50 deficiency or mutation on mitochondrial function?

Studies on TIMM50 (the human homolog of Tim50) have revealed significant effects of mutations on mitochondrial function. A recent investigation characterized a disease-causing mutation in TIMM50 in human fibroblasts and observed significant decreases in TIM23 core protein levels . This observation suggests that Tim50 is not only functionally important but also structurally significant for maintaining the integrity of the TIM23 complex.

The consequences of Tim50 deficiency appear to extend beyond mitochondrial protein import to affect other mitochondrial functions and even influence cellular processes outside the mitochondria. For instance, the TIMM50 mutation study noted effects on neuronal excitability, indicating a broader impact of mitochondrial import dysfunction on cellular physiology .

In fungal models, Tim50 has been shown to be essential for viability. Depletion of Tim50 results in severely compromised mitochondrial protein import, which would significantly impair respiratory function and other essential mitochondrial activities .

How can genetic approaches be used to study Tim50 function in Neosartorya/Aspergillus species?

Although specific genetic studies of Tim50 in Neosartorya are not detailed in the search results, approaches used for related proteins in Aspergillus fumigatus provide useful insights:

  • Conditional expression systems: The tetracycline-inducible system (tetOn) has been successfully used to study essential genes in Aspergillus fumigatus, as demonstrated with Bcs1A . A similar approach could be applied to Tim50, allowing for controlled depletion of the protein and assessment of the resulting phenotypes.

  • Complementation studies: The functionality of Neosartorya Tim50 can be assessed through heterologous expression in model organisms with Tim50 deficiency. This approach has been demonstrated with Bcs1 homologs, where researchers tested whether Aspergillus fumigatus Bcs1 homologs could complement Bcs1 deficiency in Saccharomyces cerevisiae .

  • Site-directed mutagenesis: Introducing specific mutations in conserved domains of Tim50 can help identify functionally important residues and domains.

  • Phenotypic analysis: Assessing growth characteristics, mitochondrial morphology, respiratory capacity, and stress responses in Tim50-depleted or mutant strains can provide insights into its functional importance.

How does Tim50 function compare between different fungal species?

The search results don't provide direct comparisons of Tim50 across different fungal species, but we can infer some important considerations:

  • Conservation of core function: The fundamental role of Tim50 in mitochondrial protein import appears to be conserved across species. Studies in Neurospora crassa have demonstrated its essential role in preprotein recognition and transfer from the TOM to the TIM23 complex , which likely applies to Neosartorya and Aspergillus species as well.

  • Species-specific adaptations: Different fungal species may have evolved adaptations in their mitochondrial import machinery to suit their ecological niches and physiological requirements. For example, the thermotolerance differences between Aspergillus fumigatus and Neosartorya species might be reflected in adaptations of their mitochondrial proteins, including Tim50.

  • Structural variations: While the core domains of Tim50 (transmembrane segment and large intermembrane space domain) are likely conserved, sequence variations might affect interactions with species-specific preproteins or other components of the import machinery.

How can studies of Tim50 contribute to understanding antifungal resistance mechanisms?

Understanding Tim50 and mitochondrial function in pathogenic fungi like Neosartorya and Aspergillus species could provide insights into antifungal resistance mechanisms:

  • Metabolic adaptation: Mitochondrial function plays a crucial role in fungal metabolism and stress responses. Alterations in mitochondrial proteins like Tim50 might contribute to metabolic adaptations that enhance survival under antifungal stress.

  • Comparative resistance studies: The approach used to study resistance development to antifungal proteins like NFAP2 could be applied to investigate whether mitochondrial dysfunction influences susceptibility to conventional antifungals .

  • Stress response correlation: Studies have shown that resistance to certain compounds can affect tolerance to various stresses. For example, NFAP2-resistant strains showed decreased tolerance to cell wall, heat, and UV stresses . Similarly, investigating whether Tim50 mutations or dysfunction affects stress tolerance could provide insights into broader resistance mechanisms.

  • Fitness costs: Research on antifungal resistance has demonstrated that developing resistance can come with fitness costs . Exploring whether alterations in mitochondrial import via Tim50 dysfunction impact fungal fitness could help predict the evolutionary stability of resistance mechanisms targeting mitochondrial functions.

What role might Tim50 play in the virulence and pathogenicity of Neosartorya species?

Although direct evidence linking Tim50 to virulence in Neosartorya species is not provided in the search results, several connections can be made:

  • Metabolic requirements for infection: Proper mitochondrial function is essential for the metabolic flexibility required during host invasion and adaptation to the host environment. As a key component of mitochondrial protein import, Tim50 would be crucial for maintaining this metabolic capacity.

  • Stress adaptation: Pathogenic fungi must adapt to various stresses during infection, including oxidative stress from host immune cells. Studies have shown that Neosartorya species differ from Aspergillus fumigatus in their susceptibility to neutrophil attack and hydrogen peroxide . These differences might partially relate to mitochondrial function and, by extension, to proteins like Tim50.

  • Growth characteristics: The longer germination time observed for Neosartorya conidia compared to A. fumigatus might reflect differences in metabolic activation during germination, which could involve mitochondrial proteins including Tim50.

What are the technical challenges in studying Tim50 interactions in the mitochondrial membrane?

Investigating Tim50 interactions within the mitochondrial membrane presents several technical challenges:

  • Membrane protein complexes: As a component of the TIM23 complex embedded in the inner mitochondrial membrane, Tim50 requires specialized approaches for isolation while maintaining native interactions. Detergent selection, concentration, and solubilization conditions significantly impact complex integrity.

  • Transient interactions: The interactions between Tim50 and preproteins are often transient and dynamic. Capturing these interactions requires approaches like chemical cross-linking , which must be carefully optimized to capture authentic interactions while avoiding artifacts.

  • Reconstitution systems: To study mechanistic details, reconstitution of Tim50 and the TIM23 complex in artificial membrane systems may be necessary, which presents technical challenges in maintaining physiological activity.

  • In vivo studies: Monitoring Tim50 function in living cells requires developing non-disruptive approaches, such as fluorescent protein tagging or other labeling strategies that do not interfere with its essential functions.

How can cross-linking studies be optimized to investigate Tim50-preprotein interactions?

Based on successful approaches in the literature, optimization of cross-linking studies should consider:

  • Cross-linker selection: DFDNB has been successfully used at 200 μM concentration to capture Tim50-preprotein interactions . The choice of cross-linker depends on the distance between interaction partners and the amino acids involved.

  • Reaction conditions: Cross-linking is typically performed at low temperatures (on ice) for 30 minutes, followed by quenching with glycine (1 M, pH 8.8) .

  • Preprotein preparation: For in vitro translated preproteins, radiolabeling with [35S]methionine enables detection of cross-linked products by autoradiography .

  • Preprotein arrest strategies: Various approaches can be used to accumulate preproteins at specific import stages:

    • Dissipating membrane potential with uncouplers (50 μM CCCP, 0.5 μM valinomycin)

    • Using folded domains (like DHFR with methotrexate) to create spanning intermediates

    • Sequential import steps with controlled restoration of import conditions

  • Analysis methods: Immunoprecipitation with antibodies against the N-terminal peptide of Tim50 followed by SDS-PAGE and autoradiography has been effective for analyzing cross-linked products .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.