Recombinant Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim54 (tim54)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for prioritized development.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
tim54; AFUA_4G11900; Mitochondrial import inner membrane translocase subunit tim54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
tim54
Target Protein Sequence
MIFFTITGSLTAAIVYDRRERRRVQQKWCDLVAHLSKETLPIEQTRRKLTIFLSAPPGDG
LRIAREHFKEYVKPILVAAALDYTVIEGRREGDVRAALAERIRKHRRKAGEPSSVVEEMS
NEDIIADARQKIGVVEEPGPKGDLVIGRHTWKEYIRGLHEGWLGPLDPPSPPDAPVKGPS
VPVEGSETPADGTPAEENTEKKEEAEKKDDKPAKPSGPTPAYVSPAEYSSRSLPPTLPQS
LDSSVPIPFPHLLGFLNTPIRLYRYLSRRHLADEIGREVAGLVLASSSRPYHDGSFSSDS
ELSGAMVDAGASTLSSPDDMMPSSSAKYEQQTVLEKEESEWHKSVHKRDEENPDKEREWI
DDIVLDPRIASRMQRSLLSADEEARSQRITEGKEYILGEERPAPVSFWQRMWIKYGYGED
EETIRMKPIIGNLDGADGE
Uniprot No.
Target Background
Function
Recombinant Neosartorya fumigata Mitochondrial Import Inner Membrane Translocase Subunit Tim54 (Tim54): An essential component of the TIM22 complex, this protein mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex functions as a twin-pore translocase, utilizing the membrane potential as its driving force.
Database Links
KEGG: afm:AFUA_4G11900
Protein Families
TIM54 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
