Recombinant Neosartorya fumigata Mitochondrial inner membrane magnesium transporter mrs2 (mrs2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development.
Synonyms
mrs2; AFUA_6G02550; Mitochondrial inner membrane magnesium transporter mrs2; RNA-splicing protein mrs2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-597
Protein Length
Full Length of Mature Protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
mrs2
Target Protein Sequence
SSTWTCTASAPHRTTLQTSLVRTPTPAARSHSSSRPRLWLCAGQAGRSSSIFPLSNAPYS RSASTKSRPLLRRLLDLRRSNSSADKHNRGGPALIDDGTEGGFTIGRGLAAKATNEPRLR CTEFDKNGNVTLVNGEFKKSELIAKYGLLPRDLRKIDSSTLPHILVRPSAILINLLHLRV LIKHDRVLVFDAYGSTDSYMQSLFVYDLEGKLQQKQTGGFGALPYEFRALEAVLISVTTG LEEEFNGVREPVVRVLRALEEDIDRDKLRHLLIYSKKLGTFEQKARLVRDAIDDLLEADD DLAAMYLTERANGVQREEDDHQEVEMLLESYHKVCDEIVQASGNLVTSIRNTEEVVKAIL DANRNSLMLLDLKFSIGTLGLATGTLFSALYGMNLKNFIEESDLGFGAVSMTCFMITAVV CVYGLAKLRKLQRVRMWGEAGVGGAPLTPLTTRSGILSGHRSNWRADSIEPVWGSLPGEA RTERIKRLRETAAAAAARSASADATAQRASALRSSANANGGAPKGSEHSPTRETEASGSS A
Uniprot No.

Target Background

Function
Recombinant *Neosartorya fumigata* Mitochondrial inner membrane magnesium transporter mrs2 (mrs2) is a high-conductance magnesium-selective channel mediating magnesium influx into the mitochondrial matrix. It plays a crucial role in mitochondrial mRNA group II intron splicing by modulating mitochondrial magnesium concentrations, essential for this process. Furthermore, mrs2 suppresses various mitochondrial intron mutations, and its absence can disrupt the assembly of mitochondrial membrane complexes.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Questions

Q: What is Neosartorya fumigata and how does it relate to Aspergillus fumigatus?

A: Neosartorya fumigata is a heat-resistant fungal species that is phylogenetically and morphologically very closely related to Aspergillus fumigatus. In fact, Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) is now recognized as Aspergillus fumigatus in many taxonomic classifications . Unlike A. fumigatus, which has not been reported as a spoilage agent in heat-processed foods, Neosartorya species cause spoilage in heat-processed acidic foods due to their formation of heat-resistant ascospores . These fungi are saprotrophic, meaning their primary habitat is soil, from which they have adapted various survival mechanisms .

Q: What is the mitochondrial inner membrane magnesium transporter MRS2?

A: The MRS2 protein (gene name: mrs2; AFUA_6G02550) is a mitochondrial inner membrane magnesium transporter that facilitates the uptake of magnesium ions (Mg²⁺) into the mitochondrial matrix . Beyond its primary role in magnesium transport, MRS2 has also been identified as an RNA-splicing protein, suggesting a multifunctional role in cellular processes . Research has demonstrated that MRS2 functions as a critical regulator of mitochondrial magnesium homeostasis, which in turn affects various mitochondrial functions including calcium handling through the Mitochondrial Calcium Uniporter (MCU) complex .

Advanced Questions

Q: How does MRS2 protein structure influence its magnesium transport mechanism in fungal mitochondria?

A: The MRS2 protein's structure-function relationship in fungi involves specific transmembrane domains that create a selective pore for Mg²⁺ transport across the inner mitochondrial membrane. Research utilizing sub-organellar localization studies has confirmed MRS2's orientation within the mitochondrial inner membrane, with its functional domains facing the mitochondrial matrix . The protein maintains magnesium homeostasis through a precisely regulated transport mechanism that responds to matrix and intermembrane space Mg²⁺ concentrations. Experimental evidence using membrane permeabilization with agents like mastoparan (for outer membrane) and alamethicin (for inner membrane) has helped establish this orientation and functional topology . Understanding these structural elements is crucial for researchers exploring the evolutionary conservation of MRS2 across species and its potential as a target for antifungal development.

Q: What are the implications of MRS2 knockout on mitochondrial function in different model organisms, and how do these findings translate to fungal systems?

A: MRS2 knockout studies across model organisms reveal its critical role in maintaining mitochondrial magnesium homeostasis, with cascading effects on multiple mitochondrial functions. In liver-specific Mrs2 knockout mouse models generated using CRISPR/Cas9 strategies (Mrs2Δhep), researchers observed significant alterations in mitochondrial magnesium uptake without affecting the expression of other mitochondrial proteins like OXPHOS complex components, MCU, MICU1, and MCUR1 . Unexpectedly, Mrs2 deletion led to increased MCU activity and enhanced mitochondrial calcium uptake, as demonstrated through simultaneous measurements of calcium uptake and membrane potential (Δψm) in permeabilized cell systems . These findings suggest that mitochondrial magnesium, regulated by MRS2, serves as a physiological inhibitor of MCU activity. When translating these findings to fungal systems, researchers must consider the unique metabolic requirements and lifecycle stages of Neosartorya fumigata, particularly given its adaptation to extreme environments that may require distinctive magnesium regulation mechanisms.

Basic Questions

Q: What PCR-based methods are available for identifying Neosartorya species in research samples?

A: Researchers have developed specific PCR methods to identify Neosartorya species with high accuracy. These methods utilize primer sets designed based on β-tubulin and calmodulin genes, which contain regions that can specifically detect and differentiate Neosartorya species from Aspergillus fumigatus . The PCR methodology involves:

  • DNA extraction from fungal samples

  • PCR amplification using species-specific primer sets

  • Gel electrophoresis for visualization of amplified products

  • Comparison with positive controls for species identification

This approach allows for rapid and simple identification with extremely high specificity, crucial for research involving Neosartorya fischeri, N. glabra, N. hiratsukae, N. pseudofischeri, and N. spinosa-complex, which vary in heat resistance and mycotoxin production . These PCR methods do not detect other fungi involved in food spoilage or environmental contamination, making them valuable for specific research applications.

Q: How is recombinant MRS2 protein typically produced for research applications?

A: Recombinant MRS2 protein from Neosartorya fumigata can be produced using several expression systems, each with distinct advantages depending on research needs:

Expression SystemProduct Code ExampleAdvantagesTypical Applications
YeastCSB-YP706343NGS1Post-translational modifications similar to fungiStructural studies, functional assays
E. coliCSB-EP706343NGS1High yield, cost-effectiveAntibody production, preliminary studies
E. coli with Avi-tag BiotinylationCSB-EP706343NGS1-BSite-specific biotinylation for detectionProtein interaction studies, pull-down assays
BaculovirusCSB-BP706343NGS1Complex eukaryotic modificationsActivity assays, structural analysis
Mammalian cellCSB-MP706343NGS1Most complex modificationsFunctional studies mimicking in vivo conditions

The recombinant protein is typically provided as a lyophilized powder with >85% purity (SDS-PAGE verified) and recommended to be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

Advanced Questions

Q: How can researchers optimize mitochondrial isolation protocols to maintain MRS2 functionality for in vitro transport assays?

A: Optimizing mitochondrial isolation while preserving MRS2 functionality requires a carefully calibrated protocol that balances organelle integrity with protein activity. Researchers should implement a multi-step approach:

  • Tissue or cell preparation: Use gentle homogenization techniques (Dounce homogenizer with controlled strokes) in isotonic isolation buffer (225 mM mannitol, 75 mM sucrose, 10 mM HEPES, pH 7.4) supplemented with 0.5 mM EGTA and 0.5% BSA.

  • Differential centrifugation optimization: Initial centrifugation at 1,000g for 10 minutes to remove debris, followed by supernatant centrifugation at 10,000g for 10 minutes to collect mitochondria, with all steps performed at 4°C.

  • Magnesium preservation strategy: Include 1-2 mM Mg²⁺ in all buffers to stabilize MRS2 conformation, but avoid excessive concentrations that might saturate transport sites.

  • Functional verification: Employ a dual-assessment approach combining Western blot verification of MRS2 presence with a rapid magnesium uptake assay using mag-fura-2 fluorescence to confirm functionality.

For transport assays, researchers should use a buffer system containing 125 mM KCl, 20 mM HEPES (pH 7.2), and 5 mM succinate as the energizing substrate. Magnesium transport can be measured using mag-fura-2 ratio fluorescence or ²⁸Mg²⁺ isotope uptake, with optimal assay temperature at 30°C to balance transport activity with mitochondrial stability .

Q: What approaches can be used to study the interaction between MRS2 and the Mitochondrial Calcium Uniporter (MCU) complex, and how might these methods be adapted for fungal-specific investigations?

A: Investigating MRS2-MCU interactions requires sophisticated methodological approaches that can be adapted for fungal systems:

  • Simultaneous electrophysiological and ion flux measurements:

    • Implement mitoplast patch-clamp recordings coupled with calcium flux measurements to measure MCU activity (IMCU) while manipulating magnesium concentrations

    • For fungal-specific adaptations, adjust patch solutions to reflect the unique ionic composition of Neosartorya mitochondria

  • Protein-protein interaction analysis:

    • Employ co-immunoprecipitation assays using anti-Flag antibodies on cells expressing MRS2-Flag to identify potential binding partners within the MCU complex

    • For fungal systems, develop species-specific antibodies or incorporate epitope tags that don't interfere with protein function

  • Live-cell dynamics and localization:

    • Use permeabilized cell systems with digitonin (40 μg/ml) followed by selective membrane permeabilization (mastoparan for outer membrane, alamethicin for inner membrane)

    • For fungi, optimize permeabilization conditions considering their unique cell wall composition

  • Genetic manipulation approaches:

    • Generate conditional knockout systems using CRISPR/Cas9 with selectable markers appropriate for filamentous fungi

    • Create chimeric proteins by domain swapping between fungal and mammalian MRS2 to identify species-specific functional regions

  • Mathematical modeling:

    • Develop computational models incorporating magnesium-calcium cross-regulation specific to fungal mitochondrial physiology

    • Validate with experimental data from permeabilized hyphal preparations

Research has shown that Mrs2Δhep cells exhibit increased MCU activity, suggesting that mitochondrial magnesium regulated by MRS2 serves as a critical inhibitor of MCU function . Adapting these methods for Neosartorya requires considering the organism's unique cell biology, including its resilient cell wall and specialized growth conditions.

Basic Questions

Q: What is the biological role of MRS2 in fungal mitochondrial function?

A: MRS2 plays several critical roles in fungal mitochondrial function:

  • Magnesium homeostasis: It serves as the primary transporter for magnesium ions across the inner mitochondrial membrane, maintaining optimal matrix Mg²⁺ concentrations necessary for numerous enzymatic reactions .

  • Energy metabolism regulation: By controlling matrix magnesium levels, MRS2 indirectly regulates the activity of key metabolic enzymes that require magnesium as a cofactor, including those involved in the tricarboxylic acid cycle and oxidative phosphorylation.

  • Calcium signaling modulation: MRS2-regulated magnesium levels act as a physiological inhibitor of the Mitochondrial Calcium Uniporter (MCU), evidenced by increased MCU activity in Mrs2 knockout models .

  • RNA processing: Beyond ion transport, MRS2 functions as an RNA-splicing protein, potentially influencing mitochondrial gene expression and protein synthesis .

For Neosartorya fumigata specifically, these functions likely contribute to the organism's remarkable environmental adaptability, including its ability to withstand heat treatments that would eliminate most other fungi, a critical factor in its role as a food spoilage agent .

Q: How does MRS2 contribute to fungal heat resistance and environmental adaptation?

A: MRS2's contribution to Neosartorya fumigata's heat resistance and environmental adaptation stems from several interconnected mechanisms:

  • Mitochondrial integrity maintenance: By regulating magnesium homeostasis, MRS2 helps maintain mitochondrial membrane stability under thermal stress conditions.

  • Metabolic flexibility support: Proper magnesium concentrations are essential for the activity of numerous metabolic enzymes, allowing the fungus to adapt its energy production pathways under different environmental conditions.

  • Stress response coordination: MRS2-mediated magnesium transport likely participates in cellular stress response mechanisms by influencing calcium signaling pathways, as demonstrated by the interplay between MRS2 and the Mitochondrial Calcium Uniporter .

  • Ascospore formation: Although not directly evidenced in the search results, the mitochondrial health maintained by MRS2 may contribute to the formation of the heat-resistant ascospores that allow Neosartorya species to survive heat processing in food products .

Neosartorya species are particularly significant in food safety due to their heat resistance, which enables them to survive conventional heat treatments and subsequently produce mycotoxins like fumitremorgins and gliotoxin in contaminated food products .

Advanced Questions

Q: How does mitochondrial magnesium concentration, regulated by MRS2, influence cellular bioenergetics in Neosartorya fumigata under various stress conditions?

A: Mitochondrial magnesium concentration represents a critical regulatory node for cellular bioenergetics in Neosartorya fumigata, especially under stress conditions. The MRS2 transporter dynamically modulates matrix Mg²⁺ levels, which affects numerous aspects of mitochondrial function through both direct and indirect mechanisms:

  • Oxidative phosphorylation regulation:

    • Mg²⁺ serves as an essential cofactor for ATP synthase and several respiratory chain complexes

    • Under stress conditions, optimal Mg²⁺ concentrations maintain ATP production efficiency despite environmental challenges

  • Membrane potential stabilization:

    • Matrix Mg²⁺ influences inner membrane permeability to protons and other ions

    • This regulatory role is particularly important during heat stress, where membrane fluidity increases

  • Reactive oxygen species (ROS) management:

    • Mg²⁺ modulates the activity of antioxidant enzymes and influences electron transport chain coupling

    • This is crucial for Neosartorya's survival during oxidative stress encountered in host environments

  • Cation homeostasis integration:

    • Mg²⁺ serves as a competitive regulator of MCU-mediated calcium uptake, as evidenced by increased MCU activity in Mrs2 knockout models

    • This cross-regulation helps maintain mitochondrial cation balance during stress-induced calcium signaling

Research using simultaneous measurements of mitochondrial calcium uptake and membrane potential (Δψm) has demonstrated that MRS2 deletion significantly alters calcium handling without affecting baseline mitochondrial protein expression . For Neosartorya specifically, this magnesium-calcium relationship likely contributes to the fungus's remarkable adaptability across diverse environmental conditions, including the thermal resistance that makes it a significant food safety concern.

Q: What are the molecular mechanisms underlying the cross-talk between MRS2-mediated magnesium transport and calcium homeostasis in fungal mitochondria, and how might this be exploited for antifungal development?

A: The molecular cross-talk between MRS2-mediated magnesium transport and calcium homeostasis in fungal mitochondria represents a sophisticated regulatory network with significant therapeutic potential:

  • Direct ionic competition mechanism:

    • Mg²⁺ and Ca²⁺ compete for binding sites within the MCU pore, with magnesium serving as a physiological inhibitor

    • Evidence from mitoplast patch-clamp recordings in Mrs2Δhep models shows increased MCU current (IMCU), confirming this regulatory relationship

  • Conformational modulation pathway:

    • Magnesium binding to MICU1/MICU2 regulatory components alters their calcium-sensing properties

    • This creates a sophisticated threshold mechanism where magnesium levels determine calcium uptake sensitivity

  • Membrane potential effects:

    • Mg²⁺ transport through MRS2 influences local membrane potential, indirectly affecting the driving force for calcium entry

    • This electrophysiological coupling creates dynamic feedback loops between the two transport systems

  • Signaling pathway integration:

    • MRS2-regulated magnesium levels influence calcium-dependent mitochondrial enzymes and metabolic pathways

    • This coordination is particularly important during transition between growth states in fungi

Potential antifungal strategies targeting this cross-talk include:

  • MRS2 inhibitors that disrupt fungal magnesium homeostasis while sparing human homologs

  • Compounds that exploit fungal-specific aspects of the MRS2-MCU interaction

  • Dual-targeting molecules that simultaneously disrupt both magnesium and calcium transport

  • Stress-inducing agents that overwhelm the adaptive capacity of this regulatory system

The unique aspects of fungal MRS2 and its regulatory network present promising targets, especially given the evidence that disrupting this system significantly alters mitochondrial function without compensatory adaptations in protein expression levels .

Basic Questions

Q: What are the key research applications for recombinant Neosartorya fumigata MRS2 protein?

A: Recombinant Neosartorya fumigata MRS2 protein serves numerous valuable research applications:

  • Structural biology studies: The purified protein enables crystallography or cryo-electron microscopy to determine the three-dimensional structure of fungal magnesium transporters, which differs from bacterial and mammalian homologs.

  • Transport assays: Reconstituting the recombinant protein in liposomes allows for detailed kinetic and specificity studies of magnesium transport mechanisms.

  • Antibody development: The recombinant protein serves as an antigen for generating specific antibodies useful in localization studies and protein detection assays.

  • Protein interaction studies: Biotinylated versions (like CSB-EP706343NGS1-B) facilitate pull-down assays to identify binding partners within the mitochondrial membrane .

  • Fungal identification: As a species-specific protein, antibodies against MRS2 could complement PCR-based identification methods for Neosartorya species in research and food safety applications .

The availability of recombinant MRS2 from various expression systems (yeast, E. coli, baculovirus, and mammalian cells) provides researchers flexibility in choosing the most appropriate form for their specific application .

Q: How do researchers distinguish between Neosartorya and Aspergillus species in experimental samples?

A: Researchers employ several complementary methods to distinguish between Neosartorya and Aspergillus species in experimental samples:

  • PCR-based molecular identification:

    • Specific primer sets targeting the β-tubulin and calmodulin genes have been developed to differentiate Neosartorya species from Aspergillus fumigatus at the species level

    • These PCR methods are rapid, simple, and exhibit extremely high specificity

  • Morphological examination:

    • While the species are phylogenetically and morphologically very close, careful microscopic examination of ascospore formation can help differentiate them

    • Neosartorya species produce distinctive heat-resistant ascospores not typically observed in Aspergillus fumigatus

  • Heat resistance testing:

    • Neosartorya species demonstrate significantly higher heat resistance due to their ascospores

    • Controlled heating protocols can distinguish between the genera based on survival rates

  • Mycotoxin profiling:

    • Analysis of specific mycotoxins (fumitremorgins and gliotoxin) production patterns can provide additional confirmation

    • Different species show characteristic toxin production profiles

This multi-method approach is particularly important in research contexts where precise species identification is critical for experimental validity and reproducibility.

Advanced Questions

Q: What are the potential implications of MRS2 research for developing novel antifungal strategies against invasive aspergillosis?

A: MRS2 research provides several promising avenues for novel antifungal development against invasive aspergillosis, addressing the urgent need for alternatives to current therapies constrained by toxicity and resistance issues:

  • Selective targeting strategies:

    • Exploiting structural differences between fungal and human MRS2 homologs to develop selective inhibitors

    • Computational approaches using evolutionary conservation analysis can identify fungal-specific binding pockets

    • Rational drug design targeting these unique regions could minimize off-target effects on human mitochondria

  • Mitochondrial bioenergetic disruption:

    • MRS2 inhibition would create cascading effects on fungal mitochondrial function

    • The resulting magnesium dysregulation would disrupt numerous magnesium-dependent enzymes crucial for energy production

    • This multi-target effect could potentially overcome single-target resistance mechanisms

  • Host-pathogen interaction exploitation:

    • Aspergillus fumigatus encounters diverse microenvironments during infection progression

    • MRS2's role in environmental adaptation makes it particularly relevant during host colonization

    • Compounds that interfere with this adaptation process could reduce virulence without directly killing the fungus

  • Combination therapy approaches:

    • MRS2 inhibitors could synergize with existing antifungals by compromising fungal adaptation mechanisms

    • The magnesium-calcium cross-regulation pathway offers opportunities to simultaneously target multiple ion transport systems

    • This polypharmacology approach might address the limitations of current monotherapies

These strategies are particularly relevant given Aspergillus fumigatus's role in various forms of aspergillosis, including chronic pulmonary aspergillosis, which affects over 350,000 patients annually following treated pulmonary tuberculosis .

Q: How might systems biology approaches integrate MRS2 function into broader models of fungal mitochondrial dynamics under environmental stressors?

A: Systems biology approaches can integrate MRS2 function into comprehensive models of fungal mitochondrial dynamics by establishing multi-level analytical frameworks that capture the complex interplay between magnesium homeostasis and broader cellular processes:

  • Multi-omics integration methodology:

    • Combine transcriptomics data from MRS2 knockout/knockdown studies with proteomics and metabolomics profiles

    • Map resulting datasets onto established mitochondrial pathways using weighted correlation network analysis

    • Identify emergent properties and regulatory nodes that connect magnesium transport to global mitochondrial functions

  • Flux balance analysis adaptations:

    • Develop constraint-based metabolic models incorporating magnesium as an essential cofactor

    • Parameterize with experimental data from Mrs2 knockout studies showing altered MCU activity

    • Simulate metabolic flux redistribution under various environmental stressors with normal or impaired MRS2 function

  • Agent-based modeling of mitochondrial dynamics:

    • Create computational simulations where individual mitochondria function as autonomous agents with MRS2-dependent properties

    • Incorporate fusion/fission dynamics influenced by ion homeostasis

    • Model population-level responses to environmental perturbations like temperature shifts relevant to heat-resistant fungi

  • Network-based stress response mapping:

    • Construct protein-protein interaction networks centered on MRS2 and connected mitochondrial transport systems

    • Apply network perturbation algorithms to predict system-wide effects of environmental stressors

    • Validate computational predictions with targeted experimental approaches

Such integrated models would provide unprecedented insight into how Neosartorya fumigata achieves its remarkable environmental adaptability, particularly its characteristic heat resistance that enables survival in heat-processed food products and its pathogenic potential in various forms of aspergillosis .

Basic Questions

Q: What are common challenges in working with recombinant Neosartorya fumigata MRS2 protein, and how can they be addressed?

A: Researchers working with recombinant Neosartorya fumigata MRS2 protein frequently encounter several challenges that require specific technical solutions:

  • Protein solubility issues:

    • Challenge: As a membrane protein, MRS2 tends to aggregate during purification and storage

    • Solution: Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol, and aliquot for long-term storage at -20°C/-80°C to prevent freeze-thaw cycles

  • Functional activity preservation:

    • Challenge: Transport proteins often lose functionality during purification

    • Solution: Select the expression system that maintains post-translational modifications needed for activity; for instance, use mammalian cell-expressed protein (CSB-MP706343NGS1) for functional assays

  • Antibody cross-reactivity:

    • Challenge: High conservation between fungal species can lead to non-specific antibody binding

    • Solution: Use highly purified protein (>85% by SDS-PAGE) for antibody production and validate specificity against related fungal species

  • Functional verification:

    • Challenge: Confirming that the recombinant protein retains transport activity

    • Solution: Implement liposome reconstitution assays with magnesium-sensitive fluorescent dyes to verify transport capability

These approaches help ensure that experiments utilizing recombinant MRS2 produce reliable and reproducible results in various research applications.

Q: What considerations are important when designing experiments to study MRS2 function in Neosartorya fumigata?

A: When designing experiments to study MRS2 function in Neosartorya fumigata, researchers should consider several critical factors:

  • Genetic manipulation strategies:

    • Select appropriate promoters for expression studies that reflect the natural regulation of MRS2

    • Consider inducible systems for studying essential genes if MRS2 deletion proves lethal

    • Design gene targeting constructs with appropriate selectable markers for fungal transformation

  • Growth conditions and lifecycle stages:

    • Account for Neosartorya's heat resistance when designing thermal stress experiments

    • Include conditions that trigger ascospore formation to study MRS2's role in this heat-resistant stage

    • Consider the influence of culture medium composition on magnesium availability

  • Subcellular localization verification:

    • Implement dual approaches combining fractionation with immunoblotting

    • Use digitonin permeabilization followed by specific membrane disruption with agents like mastoparan and alamethicin to confirm submitochondrial localization

  • Functional assays design:

    • Include proper controls for mitochondrial integrity during transport studies

    • Consider the interplay between magnesium transport and calcium handling through MCU

    • Design experiments that can distinguish direct MRS2 effects from secondary consequences of altered magnesium homeostasis

  • Species-specific considerations:

    • Recognize that PCR-based identification methods may be necessary to confirm species identity in experimental samples

    • Consider potential differences between laboratory strains and clinical/environmental isolates

These considerations help ensure experimental design that accurately captures the biological roles of MRS2 in this important fungal species.

Advanced Questions

Q: What cutting-edge methodologies can be applied to investigate the structural dynamics of MRS2 during magnesium transport, and how might these approaches be optimized for fungal membrane proteins?

A: Investigating MRS2 structural dynamics during magnesium transport requires sophisticated methodological approaches that can capture the protein's conformational changes in real-time. These cutting-edge techniques can be optimized for fungal membrane proteins through specific adaptations:

  • Time-resolved cryo-electron microscopy:

    • Core technique: Trap MRS2 in different conformational states using rapid freezing following timed magnesium exposure

    • Fungal optimization: Incorporate fungal-specific lipid compositions in nanodisc preparations to maintain native-like membrane environment

    • Data integration: Combine with molecular dynamics simulations to model transition states between captured conformations

  • Single-molecule Förster Resonance Energy Transfer (smFRET):

    • Core technique: Introduce fluorescent probes at strategic locations to monitor distance changes during transport cycles

    • Fungal optimization: Design cysteine-light variants that preserve fungal-specific transport kinetics

    • Analysis approach: Implement hidden Markov modeling to identify discrete conformational states and transition probabilities

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Core technique: Monitor protein regions with changing solvent accessibility during transport cycle

    • Fungal optimization: Develop optimized digestion protocols for fungal membrane proteins with unique post-translational modifications

    • Comparative approach: Analyze differences between fungal MRS2 and mammalian homologs to identify species-specific structural elements

  • Solid-state nuclear magnetic resonance (ssNMR):

    • Core technique: Determine dynamic structural elements in membrane-embedded state

    • Fungal optimization: Isotopic labeling strategies optimized for expression in fungal systems

    • Integration strategy: Combine with electrophysiological recordings to correlate structural changes with transport events

  • In silico molecular dynamics with enhanced sampling:

    • Core technique: Simulate magnesium passage through transport pathway under various conditions

    • Fungal optimization: Parameterize simulations with fungal-specific membrane compositions and physiological ion concentrations

    • Validation approach: Design experiments to test predictions about critical residues identified in simulations

These methodologies, when adapted for fungal membrane proteins, provide unprecedented insights into the molecular mechanisms of MRS2-mediated magnesium transport, potentially revealing fungal-specific features that could be exploited for selective targeting.

Q: How can researchers integrate data from MRS2 studies with broader fungal pathogenesis models to understand its role in virulence and host adaptation during invasive aspergillosis?

A: Integrating MRS2 research with fungal pathogenesis models requires sophisticated multi-scale approaches that connect molecular mechanisms to clinical outcomes:

  • Temporal transcriptomic profiling during infection progression:

    • Methodology: RNA sequencing of Aspergillus fumigata during different infection stages in animal models

    • Integration approach: Map MRS2 expression patterns alongside virulence factors and stress response genes

    • Analytical framework: Apply time-series clustering to identify co-regulated gene modules

    • Clinical correlation: Compare expression patterns between strains with different clinical outcomes

  • Spatial metabolomics of host-pathogen interface:

    • Methodology: Mass spectrometry imaging of infected tissue sections with emphasis on magnesium distribution

    • Integration approach: Correlate magnesium gradients with fungal growth patterns and immune cell infiltration

    • Technical adaptation: Develop protocols that preserve both fungal structures and host tissue architecture

    • Pathogenesis insight: Determine how magnesium availability shapes infection microenvironments

  • Conditional MRS2 modulation in vivo:

    • Methodology: Create conditional MRS2 expression systems activated during specific infection stages

    • Integration approach: Monitor effects on established virulence parameters (invasion, dissemination, immune evasion)

    • Technical requirement: Develop fungal-compatible inducible systems that function in host environments

    • Therapeutic relevance: Identify critical windows where MRS2 inhibition would most effectively reduce pathogenicity

  • Multi-omics data integration framework:

    • Methodology: Combine proteomics, metabolomics, and transcriptomics from identical infection models

    • Integration approach: Develop computational pipelines specifically designed to identify MRS2-dependent pathways

    • Analytical focus: Emphasize mitochondrial adaptations during transition from saprophytic to pathogenic lifestyle

    • Clinical application: Correlate findings with aspergillosis manifestations ranging from aspergilloma to invasive forms

  • Host-pathogen protein interaction mapping:

    • Methodology: Proximity labeling approaches to identify host proteins that interact with fungal mitochondria

    • Integration approach: Determine how MRS2-regulated processes influence these interaction networks

    • Technical innovation: Develop bioorthogonal labeling strategies compatible with fungal cell walls

    • Pathogenesis model: Incorporate findings into comprehensive models of how mitochondrial function influences virulence

This integrated approach would provide unprecedented insight into how MRS2-mediated mitochondrial magnesium homeostasis contributes to the remarkable environmental adaptability of Aspergillus fumigata and its capacity to cause various forms of aspergillosis, from chronic pulmonary infections to invasive disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.