Recombinant Neosartorya fumigata Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mia40; tim40; AFUA_7G05420; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-297
Protein Length
Full Length of Mature Protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
mia40
Target Protein Sequence
ISTAPPDAKSRSWKSTIVRLGLAAGAVYYYNTSSVFAEQPSLSFLSKQSTPDSSDETQLP TIDSIKPRIREERQAESKAVSQPDAQPTQHEALSASEAALKSPQELEDEAGQEAAFNPET GEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSTEEPKGMDCIDKFKGMQECFRRYPDVYG AELEDDDEADAAAATAAGVSEPSEQPASPTVSAPTAEIDASSDSEGKEGRAKDVHAQVKS EVAEKAEQAESDDLVPKAWHDTEGTKAQQTEK
Uniprot No.

Target Background

Function

Function: Recombinant Neosartorya fumigata Mitochondrial Intermembrane Space Import and Assembly Protein 40 (Mia40) is essential for the import and folding of small, cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). It participates in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized Mia40 forms a transient intermolecular disulfide bond with the reduced precursor protein, oxidizing the precursor and enabling its intramolecular disulfide bond formation and subsequent folding within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is Mia40 and what is its fundamental role in mitochondrial protein import?

Mia40 (Mitochondrial intermembrane space import and assembly protein 40) is a central component of the protein import and assembly machinery of the mitochondrial intermembrane space (IMS). Research has established that Mia40 primarily functions as a trans-site receptor that binds incoming proteins via hydrophobic interactions, thereby mediating protein translocation into the IMS . The protein contains a conserved redox-active CPC motif and a hydrophobic substrate-binding pocket that are essential for its function .

In Neosartorya fumigata (Aspergillus fumigatus), Mia40 is encoded by the mia40 gene (also known as tim40), with the ORF name AFUA_7G05420. The full-length protein contains 297 amino acids with an expression region spanning residues 26-297 .

Methodologically, researchers studying Mia40 function typically employ targeted mutations of functional domains followed by protein import assays to assess the impact on mitochondrial protein translocation.

What are the structural characteristics of Neosartorya fumigata Mia40?

The Neosartorya fumigata Mia40 protein has the following structural features:

  • Amino Acid Sequence: ISTAPPDAKSRSWKSTIVRLGLAAGAVYYYNTSSVFAEQPSLSFLSKQSTPDSSDETQLPTIDSIKPRIREERQAESKAVSQPDAQPTQHEALSASEAALKSPQELEDEAGQEAAFNPETGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSTEEPKGMDCIDKFKGMQECFRRYPDVYGAELEDDDEADAAAATAAGVSEPSEQPASPTVSAPTAEIDASSDSEGKEGRAKDVHAQVKSEVAEKAEQAESDDLVPKAWHDTEGTKAQQTEK

  • Key Structural Motifs:

    • Contains a redox-active CPC motif critical for its oxidoreductase function

    • Features a hydrophobic substrate-binding pocket essential for substrate recognition

    • Includes conserved cysteine residues that form structural disulfide bonds

Structural analysis reveals that the substrate-binding pocket is located on the surface of Mia40 and is essential for binding substrates with internal signals (known as MISS or ITS sequences) .

How is recombinant Neosartorya fumigata Mia40 typically prepared for experimental use?

Recombinant Neosartorya fumigata Mia40 is typically prepared using the following methodology:

  • Expression System: The protein is expressed as a recombinant protein using appropriate expression systems, with tag types determined during the production process .

  • Storage Conditions:

    • Storage buffer: Tris-based buffer with 50% glycerol, optimized for the protein

    • Storage temperature: -20°C for regular storage, -20°C or -80°C for extended storage

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended

  • Quality Control:

    • Verification of proper folding and disulfide bond formation

    • Functional assays to confirm binding to substrate proteins

    • Analysis of redox activity using techniques such as thiol-trapping assays

What experimental approaches can be used to study the redox state and activity of Mia40?

Several sophisticated methods have been developed to analyze the redox state and activity of Mia40:

Redox State Analysis:

  • Thiol-trapping assays: These assays use alkylating agents such as mmPEG24 or mmPEG12 to trap free thiol groups, resulting in molecular weight shifts that can be detected by SDS-PAGE. This technique allows for the identification of different oxidation states of Mia40 .

  • Redox potential measurements: The midpoint potential (Em) of Mia40 can be measured using techniques such as:

    • Monobromobimane (mBBr) fluorescence after redox equilibration

    • Monitoring changes in intrinsic tryptophan fluorescence

    • Using redox buffers with varying ratios of DTT or GSH

Table 1: Methods for Determining Redox Potential of Mia40

MethodPrincipleAdvantagesLimitations
mBBr fluorescenceAlkylation of free thiols by mBBr produces fluorescenceSensitive detection of free thiolsBackground interference possible
Tryptophan fluorescenceChanges in protein conformation alter intrinsic fluorescenceNon-destructive, real-time monitoringInfluenced by oxygen concentration
Redox titrationEquilibration with redox buffers of known potentialQuantitative determination of Em±10 mV experimental uncertainty

How do mutations in the CPC motif and substrate-binding domain affect Mia40 function?

Functional analysis of Mia40 mutants has provided crucial insights into the protein's mechanism:

  • CPC Motif Mutations (Mia40-SPS):

    • Mutation of the redox-active CPC motif to SPS makes it redox-inactive

    • Surprisingly, Mia40-SPS can still mediate protein import with high efficiency

    • It allows accumulation of substrates in mitochondria, albeit at reduced levels

    • This indicates that the oxidoreductase activity is not essential for the translocation function

  • Substrate-Binding Domain Mutations (Mia40-FE and Mia40-STOP):

    • Mutation of conserved phenylalanine residues (F315E, F318E) in the binding pocket disrupts its structure

    • Mia40-FE fails to form proper structural disulfides in the substrate-binding domain

    • The complete absence of the substrate-binding domain in Mia40-STOP severely impairs substrate binding

    • These mutations demonstrate that the hydrophobic binding pocket is essential for substrate recognition and import

These findings support the model that Mia40 functions primarily as a trans-site receptor that drives protein import through hydrophobic interactions, while its oxidoreductase activity is a separate function not directly linked to translocation .

How can the Mia40-Erv1 oxidative folding pathway be reconstituted in vitro?

The Mia40-Erv1 oxidative folding pathway can be reconstituted in vitro using purified components, enabling detailed mechanistic studies. The methodology involves:

  • Protein Purification:

    • Expression and purification of recombinant Mia40 (with proper folding of its substrate-binding domain)

    • Expression and purification of recombinant Erv1

    • Preparation of reduced substrate proteins (such as Tim13)

  • Reconstitution Conditions:

    • Buffer composition optimized for the redox reactions

    • Controlled redox environment (presence or absence of oxygen)

    • Appropriate temperature (typically 30°C)

  • Analysis Methods:

    • Monitoring disulfide bond formation in substrate proteins using non-reducing SDS-PAGE

    • Tracking the oxidation state of Mia40 using thiol-reactive probes

    • Measuring the kinetics of substrate oxidation using fluorescence or spectroscopic techniques

The reconstituted system has demonstrated that Mia40 and Erv1 execute a disulfide relay to import small Tim proteins into the mitochondrial intermembrane space .

What is the role of Mia40 in modulating AIFM1-induced cell death and how is this influenced by metabolic status?

Recent research has uncovered a novel role for Mia40 in suppressing cell death induced by apoptosis-inducing factor 1 (AIFM1), with this function being regulated by cellular metabolic status:

  • Mechanistic Basis:

    • Mia40 interacts with AIFM1 dimers, potentially inhibiting AIFM1 nuclear translocation

    • This interaction conceals the nuclear localization signal (NLS) of AIFM1

    • The binding of Mia40 to AIFM1 prevents AIFM1-induced cell death

  • Metabolic Regulation:

    • High NADH/NAD+ ratio strengthens the interaction between Mia40 and the AIFM1 dimer

    • This renders cells resistant to AIFM1-induced cell death

    • Decrease in NADH/NAD+ balance reduces Mia40-AIFM1 interaction and recovers sensitivity to cell death

  • Complex I Connection:

    • Mia40 is crucial for importing subunits of Complex I, such as NDUFS5, NDUFB7, and NDUFA8

    • Impairment of Complex I leads to an increased NADH/NAD+ ratio

    • This metabolic imbalance enhances Mia40-AIFM1 interaction, potentially as a protective mechanism to prevent premature cell death during metabolic stress

This research has significant implications for understanding how cellular metabolism influences cell death pathways, particularly in conditions associated with mitochondrial dysfunction or metabolic stress.

How does Neosartorya fumigata Mia40 differ from its homologs in other fungi and humans?

Comparative analysis reveals significant differences between Mia40 proteins across species:

  • Size and Domain Organization:

    • Human MIA40 is significantly smaller than fungal proteins and lacks the N-terminal extension including a transmembrane region and mitochondrial targeting signal

    • Human MIA40 forms soluble complexes within the intermembrane space, in contrast to fungal Mia40 which is typically membrane-anchored

    • Neosartorya fumigata Mia40 is more similar to other fungal Mia40 proteins

  • Conserved Motifs:

    • Human MIA40 contains six highly conserved cysteine residues constituting a -CXC-CX9C-CX9C- motif

    • This twin -CX9C- motif is specifically required for import and stability of MIA40 in mitochondria

    • The CPC motif is conserved across species, indicating its fundamental importance for function

  • Localization:

    • In Saccharomyces cerevisiae, Mia40 is anchored to the inner membrane

    • In humans, MIA40 lacks the membrane anchor and is a soluble protein in the IMS

    • Neosartorya fumigata Mia40 contains features common to fungal Mia40 proteins

Understanding these species-specific differences is crucial for interpreting experimental results and developing targeted approaches for studying pathogenic fungi like Neosartorya fumigata.

What is known about Neosartorya fumigata taxonomy and its relationship to Aspergillus fumigatus?

Neosartorya fumigata is the teleomorphic (sexual) stage of Aspergillus fumigatus, a medically important fungal pathogen:

  • Taxonomic Classification:

    • Domain: Eukaryota

    • Kingdom: Fungi

    • Division: Ascomycota

    • Class: Eurotiomycetes

    • Order: Eurotiales

    • Family: Aspergillaceae

    • Genus: Aspergillus (anamorphic) / Neosartorya (teleomorphic)

    • Species: fumigatus

  • Strain Information:

    • Neosartorya fumigata strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100 is a well-characterized reference strain

    • This strain has been used for genomic sequencing and protein characterization studies

  • Taxonomic Revision:

    • Aspergillus section Fumigati with its teleomorph genus Neosartorya has been revised using a polyphasic approach

    • The section consists of 33 taxa: 10 strictly anamorphic Aspergillus species and 23 Neosartorya species

    • The species concept is based on phenotypic (morphology and extrolite profiles) and molecular (β-tubulin and calmodulin gene sequences) characteristics

The relationship between Neosartorya and Aspergillus is important for understanding the biology of this pathogen, as the sexual stage provides genetic diversity despite the relatively low genetic variation observed globally in A. fumigatus .

How might understanding Mia40 function contribute to developing antifungal strategies against Neosartorya fumigata/Aspergillus fumigatus?

Aspergillus fumigatus is a significant human pathogen that causes invasive fungal infections in immunocompromised individuals. Research on Mia40 could contribute to antifungal development through several approaches:

  • Targeting Essential Protein Import:

    • Mia40 is essential for the import of small IMS proteins required for mitochondrial function

    • Inhibition of Mia40 function could potentially disrupt mitochondrial biogenesis and function in A. fumigatus

    • Since fungal Mia40 differs structurally from human MIA40, selective targeting might be possible

  • Exploiting Metabolic Vulnerabilities:

    • A. fumigatus encounters hypoxic microenvironments during infection

    • Hypoxia affects mitochondrial function and potentially Mia40 activity

    • Understanding how Mia40 functions under hypoxic conditions could reveal targetable vulnerabilities

  • Virulence Factors:

    • Mitochondrial function is linked to various virulence attributes of A. fumigatus

    • Proteins involved in nitrogen assimilation affect virulence and may depend on Mia40 for proper localization

    • Targeting Mia40-dependent import pathways could potentially attenuate virulence

Currently, azole drugs are the primary treatment for A. fumigatus infections, but resistance is increasing. New targets in essential pathways like mitochondrial protein import represent a promising avenue for novel antifungal development.

What advanced techniques are being developed to study Mia40-substrate interactions at the molecular level?

Cutting-edge methodologies for studying Mia40-substrate interactions include:

  • Structural Biology Approaches:

    • X-ray crystallography of Mia40-substrate complexes

    • NMR spectroscopy to analyze the dynamics of interactions

    • AlphaFold and other computational modeling approaches to predict interaction interfaces

  • Real-time Interaction Analysis:

    • Single-molecule FRET to monitor Mia40-substrate binding events

    • Surface plasmon resonance to measure binding kinetics

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • In vivo Crosslinking:

    • Site-specific incorporation of photo-crosslinkable amino acids

    • In-cell NMR to analyze protein-protein interactions in the cellular environment

    • Proximity labeling techniques such as BioID or APEX to identify interacting partners

  • High-throughput Approaches:

    • Deep mutational scanning to comprehensively analyze the effects of mutations on Mia40 function

    • Proteomics analysis to identify the full complement of Mia40 substrates

    • Metabolomics to understand how metabolic status affects Mia40 function

Recent research has employed computational structural modeling to predict how Mia40 interacts with AIFM1 dimers, with models achieving ipTM+pTM scores exceeding 1, suggesting high accuracy and reliability .

How does the overexpression of Mia40 affect cellular proteostasis and protein aggregation-related pathologies?

Recent research has revealed unexpected roles for Mia40 in cellular proteostasis beyond its known function in mitochondrial protein import:

  • Protection Against Protein Aggregation:

    • Increased levels of Mia40 in the intermembrane space counteract the occurrence of aggregate-inducing nucleation seeds formed by prion-like proteins

    • Mia40 overexpression suppresses growth arrest induced by aggregation-prone polyQ proteins

    • This protective effect appears to be particularly relevant for hydrophobic precursor proteins

  • Experimental Evidence:

    • Overexpression of Mia40 was very effective in repressing polyQ toxicity

    • About half of all cells survived the GAL-driven expression of Q97-GFP for 24 hours when Mia40 was overexpressed

    • This suggests that Mia40 overexpression can protect against the formation of toxic polyQ aggregates

  • Mechanistic Explanation:

    • The mitochondrial import machinery, particularly components involved in the biogenesis of membrane proteins, appears to be important for cytosolic proteostasis

    • Regulation of the mitochondrial import machinery, especially modulation of Mia40 levels, may serve as an efficient molecular mechanism to fine-tune cytosolic protein homeostasis

    • This represents a novel connection between mitochondrial function and cellular protein quality control

These findings suggest that targeting Mia40 and the mitochondrial import machinery could be a promising approach for treating protein aggregation-related diseases, including neurodegenerative disorders characterized by protein aggregation.

What are the common challenges in working with recombinant Mia40 and how can they be addressed?

Researchers working with recombinant Mia40 face several technical challenges:

  • Maintaining Proper Redox State:

    • Challenge: Mia40 contains multiple cysteine residues that form crucial disulfide bonds. Maintaining the correct redox state is critical for function.

    • Solution: Use optimized buffer conditions (Tris-based buffer with 50% glycerol), avoid repeated freeze-thaw cycles, and store working aliquots at 4°C for up to one week . Consider adding appropriate redox agents to maintain the desired oxidation state.

  • Ensuring Proper Folding:

    • Challenge: The substrate-binding domain of Mia40 requires structural disulfide bonds for proper folding.

    • Solution: Verify proper folding using conformation-sensitive techniques such as circular dichroism or intrinsic tryptophan fluorescence. The presence of structural disulfides can be confirmed using alkylating agents like mmPEG24 or mmPEG12 and gel shift assays .

  • Functional Assessment:

    • Challenge: Determining whether recombinant Mia40 is functionally active.

    • Solution: Establish in vitro binding assays with known substrates or reconstitute the Mia40-Erv1 pathway using purified components . Monitor substrate oxidation or measure the redox potential of the recombinant protein.

  • Species-Specific Differences:

    • Challenge: Results from different species may not be directly comparable due to structural differences.

    • Solution: Consider the specific structural features of Neosartorya fumigata Mia40 compared to other fungal or human homologs. Human MIA40 lacks the N-terminal membrane anchor present in fungal proteins .

How can researchers accurately measure and interpret the redox state of Mia40 in experimental settings?

Accurate measurement of Mia40's redox state is crucial for understanding its function:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.