Recombinant Neosartorya fumigata Mitochondrial outer membrane protein iml2 (iml2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
iml2; AFUB_009780; Inclusion body clearance protein iml2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-725
Protein Length
full length protein
Species
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Target Names
iml2
Target Protein Sequence
MFRVGSWLYGKKPAANASTQSLDSLVELRDLEDAMRAATLILNDDVDGAEAGLAEGTSAF HNLGRGVVAFIRATLGFEQDIMRQASERLNEAETSASVDQHRAQHNSYAPNTYHSPMYLP GTEFALCQAIAQLMSAIVGVLNESLTESIKAFYRLRKAYITLDAILKMEQKYMEESRAAT LVESTTSGSVPSSLRHSSSNLHSSSSSISSAKGKEAAADTLAAPSNDTDVQERLADLSLS GEPAVAEDPGQTPTPINTDILDHDPDSDIFQNQIDVFVHSGSNFCFGVLLLLISMVPPSF SKLLSIIGFHGDKERGLKMLWQASKFHNLIGGIAAFAILGYYNGFVRYCDIMPDSIPGKD GDVQGYPQKRLELLLAKMRERFPKSQLWLLEESRMSGANKNLDRALELLCGEERSPLKQV EALRVFERSLNAMYLHKYELCADSFLECVDLNSWSRSLYYYIAGSCHLSLYRDVKETDSA KAAKHAELAEKYFRMAPTVAGKKRFMARQLPFDVFVARKFAKWEARAKEWKVSLVDAVGV DPIEEMIFFWNGHSRMTDEQLQESLQKLAWSESSANTTWSREGPEEKAILKLLRAAVHRS LRKHTQAKEMLEDILGQDRTLFKGHLKDDWICPVAHFEMAANLWMERPTYIATHGGAKQD SNKESARPASVNDALQYEREKVRKCKEYLEKAAKWESYELDARIGLKVTAAMEAVQKWES THPTL
Uniprot No.

Target Background

Function
A protein residing in inclusion bodies (IBs) that exhibits strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearance following protein folding stress, likely by facilitating access to IBs of an LD-stored soluble sterol derivative functioning as a chaperone in inclusion clearing.
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is Neosartorya fumigata and how is it taxonomically related to Aspergillus fumigatus?

Neosartorya fumigata is a fungal species belonging to the section Fumigati, closely related to Aspergillus fumigatus. Phylogenetically and morphologically, Neosartorya species are extremely close to A. fumigatus, with their anamorphs being nearly indistinguishable through conventional morphological analysis . The relationship is so close that microbiologists often struggle to differentiate between these species without specialized molecular techniques. Recent taxonomic studies have shown that Neosartorya can be considered the teleomorphic (sexual) state of certain Aspergillus species, with A. fumigatus being the anamorphic (asexual) counterpart . This close relationship creates significant challenges in clinical and research settings, as misidentification can lead to incorrect treatment approaches, particularly because Neosartorya species often display intrinsic resistance to certain antifungal agents that A. fumigatus may be susceptible to .

What are the structural characteristics of mitochondrial outer membrane proteins in filamentous fungi?

Mitochondrial outer membrane proteins in filamentous fungi like Neosartorya fumigata serve as crucial interfaces between the mitochondria and the cytosol. These proteins typically contain transmembrane domains that anchor them within the lipid bilayer of the outer mitochondrial membrane. The iml2 protein specifically belongs to a conserved family of mitochondrial membrane proteins found across various fungal species . Unlike the RODA protein, which is a cell wall component forming interwoven fascicules of proteinaceous microfibrils in the outer spore coat , mitochondrial membrane proteins maintain mitochondrial integrity and function through their involvement in various processes including protein import, metabolite exchange, and mitochondrial dynamics. Structural analyses using techniques such as X-ray crystallography and cryo-electron microscopy have revealed that these proteins often contain beta-barrel structures that facilitate the formation of pores across the membrane, allowing for the selective transport of molecules between the cytosol and the intermembrane space.

What expression systems are optimal for producing recombinant Neosartorya fumigata proteins?

E. coli expression systems have proven to be the most widely used and effective platforms for producing recombinant proteins from Neosartorya fumigata, including the mitochondrial outer membrane protein iml2. The bacterial expression system offers advantages including high yield, rapid growth, ease of genetic manipulation, and cost-effectiveness . When expressing Neosartorya proteins, researchers typically modify the coding sequence to optimize codon usage for E. coli while maintaining the amino acid sequence of the target protein. For optimal expression of mitochondrial membrane proteins, specialized E. coli strains such as C41(DE3) or C43(DE3) are often preferred as they are designed to accommodate potentially toxic membrane proteins.

For challenging proteins that resist proper folding in bacterial systems, alternative expression platforms such as yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells using baculovirus expression vectors, or mammalian cell lines may be employed. Each system offers distinct advantages in terms of post-translational modifications, protein folding, and yield, which must be balanced against increased complexity and cost.

What purification strategies are most effective for recombinant mitochondrial membrane proteins?

Purification of recombinant mitochondrial membrane proteins like iml2 requires specialized approaches due to their hydrophobic nature and tendency to aggregate. The most effective strategy typically involves:

  • Affinity chromatography: Utilizing tags such as the 6xHis-B2M tag (as used with RODA protein) to enable selective binding to metal affinity resins.

  • Detergent solubilization: Employing mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin to extract and solubilize the membrane proteins without denaturing them.

  • Size exclusion chromatography: To separate properly folded proteins from aggregates and remove contaminants.

  • Ion exchange chromatography: As a polishing step to achieve higher purity.

The purification protocol must be optimized for each specific protein, with careful consideration of buffer composition, pH, salt concentration, and detergent type and concentration. Purity assessment is typically performed using SDS-PAGE, with a target purity of >85% for most research applications . For structural studies, higher purity (>95%) is usually required.

How can researchers differentiate between Neosartorya fumigata and related species in experimental settings?

Distinguishing between Neosartorya fumigata and related species presents a significant challenge in research due to their morphological similarities. Researchers should implement a multi-faceted approach:

  • Molecular identification: PCR-based methods targeting the β-tubulin and calmodulin genes have proven highly effective for species-level identification. Specific primer sets have been developed to differentiate Neosartorya species from A. fumigatus with high specificity . This approach is particularly valuable as conventional sequencing methods often fail to distinguish between these closely related species.

  • Growth characteristics: Neosartorya species typically exhibit different growth rates and colony morphologies when cultured under standardized conditions. Observing defects in sporulation can provide initial indications that an isolate may not be typical A. fumigatus .

  • Antifungal susceptibility profiling: Unusual resistance patterns to azoles and other antifungals can signal the presence of Neosartorya species or other members of the A. fumigatus complex rather than A. fumigatus itself .

  • Advanced spectroscopic methods: Matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS) has shown promising results for rapid and accurate distinction between A. fumigatus and other species in the section Fumigati .

Implementing these techniques in combination provides robust identification, crucial for ensuring experimental validity when working with recombinant proteins from these organisms.

What experimental controls are essential when studying the function of recombinant iml2 protein?

When investigating the function of recombinant Neosartorya fumigata iml2 protein, implementing rigorous experimental controls is critical to ensure valid and reliable results. Based on established experimental design principles for recombinant protein research , the following controls should be considered:

  • Negative controls:

    • Empty vector controls: Cells transformed with expression vectors lacking the iml2 gene

    • Irrelevant protein controls: Expression of an unrelated protein with similar properties (size, charge) using the same vector and purification system

    • Buffer controls: To distinguish protein-specific effects from those caused by buffer components

  • Positive controls:

    • Known functional homologs: Well-characterized mitochondrial membrane proteins from related species

    • Native protein preparations: When possible, comparing recombinant protein activity with that of native protein isolated from Neosartorya fumigata

  • Quality controls:

    • Protein integrity verification: Western blotting, circular dichroism, and thermal shift assays to confirm proper folding

    • Activity benchmarks: Standardized assays to ensure batch-to-batch consistency in protein activity

  • Experimental design controls:

    • Randomization of sample processing order

    • Blinding of sample identity during analysis phases

    • Technical and biological replicates with appropriate statistical analysis

For functional studies specifically, including mutant variants of iml2 with altered key domains provides valuable insights into structure-function relationships.

How do post-translational modifications affect iml2 protein localization and function?

Post-translational modifications (PTMs) play critical roles in determining the localization, function, and interactions of mitochondrial outer membrane proteins like iml2. When studying recombinant iml2, researchers should consider:

  • Phosphorylation: Protein kinases may regulate iml2 function through reversible phosphorylation. Phosphoproteomic analysis of native iml2 can reveal phosphorylation sites that should be preserved or mimicked in recombinant systems. Expression in eukaryotic systems may be necessary to maintain proper phosphorylation patterns.

  • Lipid modifications: Many mitochondrial membrane proteins undergo lipidation (such as myristoylation or palmitoylation), which facilitates membrane association. Analysis of the iml2 sequence for potential lipidation motifs can guide expression system selection and purification strategy.

  • Proteolytic processing: Mitochondrial proteins often undergo proteolytic cleavage during import or maturation. N-terminal sequencing of native iml2 can determine if the recombinant protein should include or exclude signal sequences or pro-peptides.

  • Disulfide bond formation: The presence of conserved cysteine residues may indicate the formation of structurally important disulfide bonds. Expression systems with oxidizing environments may be preferred if disulfide bonds are critical for proper folding.

Comparing the activity and localization of recombinant iml2 expressed in systems with different PTM capabilities (bacterial vs. eukaryotic) can provide insights into the functional relevance of these modifications. Mass spectrometry-based approaches can be employed to map and quantify PTMs in both native and recombinant proteins.

What are the implications of iml2 research for developing novel antifungal strategies?

Research on the mitochondrial outer membrane protein iml2 from Neosartorya fumigata has significant implications for antifungal development strategies, particularly given the increasing concerns about intrinsic antifungal resistance in Neosartorya species . Several promising research directions include:

  • Target validation: Determining whether iml2 is essential for fungal viability or virulence through gene knockout or knockdown experiments. If iml2 proves to be an essential protein with no close human homologs, it represents a promising antifungal target.

  • Structure-based drug design: Resolving the three-dimensional structure of iml2 using X-ray crystallography or cryo-electron microscopy to identify potential binding pockets for small molecule inhibitors. This approach has been particularly successful for membrane proteins in other therapeutic areas.

  • Functional inhibition strategies: Developing compounds that specifically interfere with iml2 function rather than structure, such as inhibitors of protein-protein interactions or molecules that disrupt the protein's interaction with the lipid bilayer.

  • Differential targeting: Exploiting structural or functional differences between iml2 and related proteins in other fungi to develop species-specific antifungals. This is particularly valuable given the intrinsic resistance patterns observed in Neosartorya species compared to A. fumigatus .

  • Combinatorial approaches: Investigating potential synergistic effects between iml2 inhibitors and existing antifungals to overcome resistance mechanisms or reduce required dosages.

The development of antifungals targeting mitochondrial membrane proteins would represent a novel class of therapy, potentially circumventing existing resistance mechanisms in pathogenic fungi like Neosartorya fumigata.

How should experiments be designed to study protein-protein interactions involving iml2?

To effectively study protein-protein interactions (PPIs) involving the mitochondrial outer membrane protein iml2 from Neosartorya fumigata, researchers should implement a multi-technique approach:

  • In vitro interaction assays:

    • Pull-down assays using recombinant iml2 with potential binding partners

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

  • Cell-based interaction approaches:

    • Yeast two-hybrid (Y2H) screening with appropriate modifications for membrane proteins

    • Bimolecular fluorescence complementation (BiFC) in fungal or mammalian expression systems

    • Proximity-based labeling methods such as BioID or APEX2 to identify proteins in close proximity to iml2 in vivo

  • Structural studies of complexes:

    • Chemical cross-linking followed by mass spectrometry (XL-MS) to map interaction interfaces

    • Cryo-electron microscopy of reconstituted complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions protected upon complex formation

Careful consideration must be given to experimental conditions, particularly detergent selection and concentration when working with membrane proteins. Controls should include:

  • Negative controls with non-interacting proteins

  • Competition assays with unlabeled proteins to confirm specificity

  • Domain mapping experiments to identify specific interaction regions

  • Validation across multiple techniques to minimize method-specific artifacts

The experimental design should allow for distinguishing direct interactions from indirect associations within larger complexes, a common challenge when studying membrane protein interactions.

What approaches can resolve contradictory data regarding mitochondrial membrane protein function?

When facing contradictory data regarding the function of mitochondrial membrane proteins like iml2, researchers should implement a systematic troubleshooting approach:

  • Source evaluation:

    • Compare protein sources (different expression systems, purification methods)

    • Evaluate protein quality (purity, folding, activity) using multiple biophysical techniques

    • Consider species differences if comparing homologs from different fungi

  • Methodological reconciliation:

    • Standardize experimental conditions across laboratories

    • Develop robust positive and negative controls for functional assays

    • Implement blinded sample analysis to reduce bias

  • Hypothesis refinement strategies:

    • Consider context-dependent functions (environmental conditions, interaction partners)

    • Explore substrate specificity variation across experimental setups

    • Investigate potential redundancy with other proteins

  • Advanced experimental approaches:

    • Site-directed mutagenesis to identify critical residues for specific functions

    • In vivo validation of in vitro findings using gene replacement techniques

    • Time-resolved studies to capture dynamic functional changes

  • Statistical and data analysis:

    • Meta-analysis of published data when sufficient studies exist

    • Employ more sophisticated statistical models that account for variations in experimental conditions

    • Bayesian approaches to integrate data from multiple sources

Explicitly testing competing hypotheses through well-designed experiments, rather than simply gathering more data under identical conditions, is often the most efficient approach to resolving contradictory findings.

How can researchers optimize the stability of recombinant iml2 protein during storage and experimentation?

Maintaining the stability of recombinant mitochondrial membrane proteins like iml2 presents significant challenges. Based on established practices for similar proteins, the following strategies are recommended:

  • Optimal storage conditions:

    • Store at -20°C to -80°C for long-term stability

    • For liquid formulations, maintain in 50% glycerol to prevent freeze-thaw damage

    • Prepare working aliquots stored at 4°C for up to one week to avoid repeated freeze-thaw cycles

    • Consider lyophilization for extended shelf life (up to 12 months)

  • Buffer optimization:

    • Screen various buffer systems (HEPES, Tris, phosphate) at different pH values

    • Evaluate the impact of ionic strength on stability

    • Test stabilizing additives including:

      • Glycerol (10-50%)

      • Non-ionic detergents (DDM, LMNG, GDN)

      • Lipids or nanodiscs for membrane mimetics

      • Specific ligands or binding partners

  • Stability assessment methods:

    • Thermal shift assays to measure melting temperature under various conditions

    • Size-exclusion chromatography to monitor aggregation over time

    • Activity assays to confirm functional preservation

    • Circular dichroism to track secondary structure changes

  • Advanced stabilization approaches:

    • Protein engineering to introduce stabilizing mutations

    • Truncation or fusion constructs to remove flexible regions

    • Antibody fragment co-purification to stabilize specific conformations

    • Reconstitution into membrane mimetics (nanodiscs, liposomes)

The optimal approach should be empirically determined for iml2 specifically, as membrane protein stability is highly protein-dependent. Documentation of storage conditions, freeze-thaw cycles, and stability tests should be maintained to ensure experimental reproducibility.

How does iml2 compare structurally and functionally with other fungal mitochondrial membrane proteins?

Comparative analysis of iml2 with other fungal mitochondrial membrane proteins reveals both conserved features and unique characteristics that may provide insights into specialized functions:

  • Structural comparisons:

    • Unlike RODA protein, which forms interwoven fascicules in the cell wall , iml2 integrates into the mitochondrial outer membrane through transmembrane domains

    • Secondary structure predictions suggest a beta-barrel architecture common to many mitochondrial outer membrane proteins

    • Sequence analysis reveals conserved motifs shared with mitochondrial import machinery components in other fungi

  • Functional comparisons:

    • While RODA is involved in environmental stress resistance and conidial hydrophobicity , iml2 likely participates in mitochondrial homeostasis

    • Homology to mitochondrial outer membrane proteins in other species suggests potential roles in:

      • Protein import

      • Small molecule transport

      • Mitochondrial morphology regulation

      • Signaling between mitochondria and other cellular compartments

  • Species-specific adaptations:

    • Sequence variations between Neosartorya and Aspergillus homologs may reflect adaptations to different ecological niches

    • Differences in post-translational modification sites suggest species-specific regulatory mechanisms

    • Unique domains or motifs may confer specialized functions related to pathogenicity or stress response

Systematic comparative analyses using phylogenetic approaches, structural modeling, and functional assays across multiple fungal species can provide a more comprehensive understanding of iml2 evolution and specialization.

What emerging technologies will advance research on fungal mitochondrial membrane proteins?

Several cutting-edge technologies are poised to significantly advance research on fungal mitochondrial membrane proteins like iml2:

  • Structural biology innovations:

    • Cryo-electron microscopy advances enabling atomic-resolution structures of membrane proteins without crystallization

    • Integrative structural biology approaches combining multiple data sources (NMR, SAXS, crosslinking MS) for complete structural models

    • AlphaFold2 and other AI-based prediction tools for generating structural models of previously uncharacterized proteins

  • Functional characterization technologies:

    • Single-molecule techniques to observe real-time conformational changes and transport events

    • Advanced electrophysiology methods for characterizing channel properties

    • High-throughput functional screening using specialized yeast or bacterial reporter systems

  • Cellular and in vivo approaches:

    • CRISPR-Cas9 genome editing in filamentous fungi for precise genetic manipulation

    • Super-resolution microscopy to visualize protein localization and dynamics at unprecedented resolution

    • Organelle-specific proteomics using proximity labeling to map the mitochondrial membrane protein interactome

  • Computational and systems biology:

    • Network analysis to position iml2 within broader cellular pathways

    • Machine learning approaches to predict protein-protein interactions

    • Molecular dynamics simulations to model protein behavior in membrane environments

  • Translational applications:

    • Fragment-based drug discovery tailored to membrane protein targets

    • Nanobody development for specific inhibition or detection of iml2

    • Synthetic biology approaches to engineer fungal mitochondria for biotechnological applications

Integration of these technologies will enable a more comprehensive understanding of iml2 structure, function, and potential as a therapeutic target.

What are the key considerations for designing comprehensive studies of iml2 protein?

Designing comprehensive studies of Neosartorya fumigata mitochondrial outer membrane protein iml2 requires careful consideration of multiple factors to ensure robust and meaningful results:

  • Experimental validation hierarchy:

    • Begin with in silico analyses to predict structure, function, and interactions

    • Progress to in vitro characterization of purified recombinant protein

    • Advance to cellular studies in heterologous expression systems

    • Culminate with investigations in Neosartorya fumigata to confirm physiological relevance

  • Interdisciplinary approach integration:

    • Combine structural biology, biochemistry, cell biology, and genetics

    • Incorporate biophysical techniques for protein characterization

    • Apply systems biology to position iml2 within broader cellular networks

    • Consider evolutionary perspectives through comparative analysis

  • Technical considerations:

    • Optimize expression and purification protocols specifically for iml2

    • Develop activity assays that reflect physiological function

    • Establish appropriate membrane mimetics for in vitro studies

    • Create tools for visualization and manipulation in fungal cells

  • Experimental design principles:

    • Implement proper controls as outlined in section 2.2

    • Design experiments with sufficient statistical power

    • Include technical and biological replicates

    • Apply blinding and randomization where appropriate

  • Translational potential assessment:

    • Evaluate essentiality through conditional knockout studies

    • Assess conservation across pathogenic fungi

    • Determine druggability through structural analysis

    • Consider potential off-target effects on human homologs

By addressing these considerations systematically, researchers can develop a comprehensive understanding of iml2 that spans from molecular mechanisms to physiological significance and potential therapeutic applications.

How can researchers contribute to standardizing protocols for recombinant fungal protein production?

Standardization of protocols for recombinant fungal protein production, particularly for challenging targets like mitochondrial membrane proteins, would significantly advance the field. Researchers can contribute through:

  • Protocol documentation and sharing:

    • Publish detailed methods sections with troubleshooting notes

    • Deposit step-by-step protocols in repositories like Protocols.io

    • Create video protocols demonstrating critical techniques

    • Share negative results and failed approaches to prevent duplication of effort

  • Benchmark development:

    • Establish reference proteins for quality control

    • Define minimum reporting standards for protein production methods

    • Create standardized activity assays for functional validation

    • Develop universally applicable quality metrics

  • Community-based initiatives:

    • Participate in multi-laboratory validation studies

    • Contribute to fungal protein production databases

    • Engage in collaborative optimization efforts

    • Support open-source plasmid and strain repositories

  • Technology standardization:

    • Adopt consistent nomenclature for expression constructs

    • Standardize purification tag systems and cleavage methods

    • Define uniform conditions for stability and activity assays

    • Establish consistent methods for membrane protein reconstitution

  • Training and knowledge transfer:

    • Develop workshop series on fungal protein expression

    • Create online training resources

    • Mentor early-career researchers in specialized techniques

    • Facilitate exchanges between laboratories with complementary expertise

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.